BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0750 (405 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0623 - 18109311-18109853,18109900-18110495,18111292-181114... 29 1.1 04_03_0618 - 18071612-18072795,18073007-18073072,18074101-180741... 29 1.1 04_03_0313 + 14233049-14234362,14234558-14235523 29 1.1 03_05_0328 - 23170019-23170168,23170865-23170903,23171043-231711... 27 4.3 01_01_1214 - 9793854-9794003,9795418-9795456,9795604-9795702,979... 27 4.3 11_03_0108 + 10101717-10101724,10101927-10101962,10102242-101023... 27 5.6 08_01_0629 + 5464282-5464304,5464367-5465528 27 5.6 11_04_0007 - 12074472-12074538,12074908-12075116,12077202-120774... 27 7.5 09_04_0194 + 15504780-15506114 27 7.5 05_04_0300 - 19969066-19969535,19971216-19972686 26 9.9 >04_03_0623 - 18109311-18109853,18109900-18110495,18111292-18111493, 18111616-18111814,18112091-18112191 Length = 546 Score = 29.5 bits (63), Expect = 1.1 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 378 ISXRLVTYLIDSRTTTST*PLKTSMKLLLRRGLVFWY*HSL*HPVLY 238 + + + YLI S+ S L+ +K+ F Y HSL HP+L+ Sbjct: 318 VPNKTLHYLIHSQNDPSIRTLEIRLKVAAESAEAFSYLHSLDHPILH 364 >04_03_0618 - 18071612-18072795,18073007-18073072,18074101-18074175, 18074234-18074963 Length = 684 Score = 29.5 bits (63), Expect = 1.1 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -1 Query: 378 ISXRLVTYLIDSRTTTST*PLKTSMKLLLRRGLVFWY*HSL*HPVLY 238 + + + YLI S+ S L+ +K+ F Y HSL HP+L+ Sbjct: 441 VPNKTLHYLIHSQNDPSIRTLEIRLKVAAESAEAFSYLHSLDHPILH 487 >04_03_0313 + 14233049-14234362,14234558-14235523 Length = 759 Score = 29.5 bits (63), Expect = 1.1 Identities = 17/63 (26%), Positives = 31/63 (49%) Frame = +3 Query: 144 EFKSTKITVKMS*NIWKIQNQNWTSRNDILHNKAPGVTGNVNTKKQDLYVIIASWKFLEV 323 + KS K + + +IW I N+ W N +L + G V T+ Q++ ++ + F Sbjct: 318 KLKSQKFLLVLD-DIWSITNREWEELNALLKDGLKGSMILVTTRLQNVANLVCTNNFEPF 376 Query: 324 KLK 332 +LK Sbjct: 377 ELK 379 >03_05_0328 - 23170019-23170168,23170865-23170903,23171043-23171141, 23171214-23171342,23171915-23172061,23172959-23173089, 23173938-23174157,23174294-23174387,23174469-23174581, 23174727-23174861,23175231-23175335,23175440-23175544, 23176240-23176327,23176415-23176536,23176611-23176670, 23177434-23177529,23177620-23177772,23177865-23177951, 23179179-23179246,23179603-23179726,23180235-23180330, 23180430-23180539,23180647-23180761,23181622-23181699, 23181843-23181908,23182203-23182363,23182781-23183099 Length = 1069 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 170 YRNFSRFKFYGNKELTDKMSIRRGMSRLTPV 78 Y NF F+ YG++ L D + I MS P+ Sbjct: 844 YVNFGVFELYGDRALADALDISLKMSLSVPL 874 >01_01_1214 - 9793854-9794003,9795418-9795456,9795604-9795702, 9795779-9795907,9796473-9796619,9797513-9797643, 9798497-9798716,9798858-9798951,9799021-9799133, 9799799-9799903,9800008-9800112,9800762-9800849, 9800933-9801054,9801130-9801189,9802313-9802408, 9802506-9802658,9802752-9802838,9803995-9804062, 9804429-9804552,9805057-9805152,9805250-9805359, 9805459-9805573,9806877-9806942,9807260-9807420, 9807927-9808167 Length = 972 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 170 YRNFSRFKFYGNKELTDKMSIRRGMSRLTPV 78 Y NF F+ YG++ L D + I MS P+ Sbjct: 747 YVNFGVFELYGDRALADALDISLKMSLSVPL 777 >11_03_0108 + 10101717-10101724,10101927-10101962,10102242-10102392, 10102393-10102551 Length = 117 Score = 27.1 bits (57), Expect = 5.6 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 114 HFVS*FFVAIEFKSTK-ITVKMS*NIWKIQNQNWTSRNDILHNKAPGVT 257 H + + I+ K K I V S W + W SRND++ NK+P ++ Sbjct: 18 HIFDGWLLGIDKKKIKLILVGASAICWAL----WLSRNDLVFNKSPSIS 62 >08_01_0629 + 5464282-5464304,5464367-5465528 Length = 394 Score = 27.1 bits (57), Expect = 5.6 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = +3 Query: 204 QNWTSRNDILHNK-APGVTGNVN 269 +NW SRN+I+H K AP + + N Sbjct: 163 RNWFSRNEIMHGKPAPTIEASKN 185 >11_04_0007 - 12074472-12074538,12074908-12075116,12077202-12077463, 12077547-12078043,12078651-12078719,12079258-12079363, 12080272-12080295,12081184-12081242,12081383-12081520 Length = 476 Score = 26.6 bits (56), Expect = 7.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = -2 Query: 215 RPILVLNLPNVLRHFYRNFSRFKFYGNKEL 126 RP L+ NL NV+R F ++ F+ K+L Sbjct: 182 RPFLIKNLENVMRKFLQSLEFFEENERKKL 211 >09_04_0194 + 15504780-15506114 Length = 444 Score = 26.6 bits (56), Expect = 7.5 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -3 Query: 115 CQYVAECPGSHPCXSCL 65 C Y+A C GS P +CL Sbjct: 114 CSYIASCLGSPPSPACL 130 >05_04_0300 - 19969066-19969535,19971216-19972686 Length = 646 Score = 26.2 bits (55), Expect = 9.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 129 IN*QNVNTSRNVPAHTRAXHVSSVNRQ 49 +N +VN + +PAH+ A H NR+ Sbjct: 524 VNSSSVNATEKIPAHSAAYHGKLKNRR 550 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,117,637 Number of Sequences: 37544 Number of extensions: 149890 Number of successful extensions: 258 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 258 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 258 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 706675332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -