BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0745 (415 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1HQ01 Cluster: Ferritin isoform 2; n=1; Bombyx mori|Re... 46 4e-04 >UniRef50_Q1HQ01 Cluster: Ferritin isoform 2; n=1; Bombyx mori|Rep: Ferritin isoform 2 - Bombyx mori (Silk moth) Length = 139 Score = 45.6 bits (103), Expect = 4e-04 Identities = 22/44 (50%), Positives = 22/44 (50%) Frame = +2 Query: 284 NXXQGCRXTXSLPXCSAYYGQXKDXXXXXXXXXXXXXXXXKRSY 415 N QGCR T SLP CSAYYGQ KD KRSY Sbjct: 25 NVDQGCRRTLSLPHCSAYYGQFKDNHVVANELKALASLYLKRSY 68 Score = 38.3 bits (85), Expect = 0.062 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +1 Query: 211 MXVYALXAACXXLGVWPEEDSCYQ 282 M VYAL AC LGV EEDSCYQ Sbjct: 1 MKVYALIVACLALGVLAEEDSCYQ 24 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 281,396,127 Number of Sequences: 1657284 Number of extensions: 3814468 Number of successful extensions: 4853 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4853 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 19042509735 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -