BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0738 (414 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles ... 66 6e-13 AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. 24 2.5 AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. 24 2.5 AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. 24 2.5 AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. 22 7.7 >U50472-1|AAA93475.1| 141|Anopheles gambiae protein ( Anopheles gambiae putativefatty acid binding protein mRNA, partial cds. ). Length = 141 Score = 65.7 bits (153), Expect = 6e-13 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = +2 Query: 68 GXKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLXXSSTFKT 232 G KYKM SE FD++M +GVG++ RK N+++PTVEL K+GDEY S +T Sbjct: 35 GKKYKMEKSEGFDDYMLALGVGMVLRKLGNSISPTVELVKNGDEYTFNTLSPSRT 89 Score = 36.7 bits (81), Expect = 3e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 259 EFEEDRADGAKVKSVCTFEGXTLKQVQK 342 EF+E+ DG VKSVCTF+G L QK Sbjct: 99 EFDEETVDGRMVKSVCTFDGNKLIHEQK 126 >AY341159-1|AAR13723.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 2.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 146 KAANAVTPTVELRKDGDEYNLXXSST 223 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341158-1|AAR13722.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 2.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 146 KAANAVTPTVELRKDGDEYNLXXSST 223 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341157-1|AAR13721.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 23.8 bits (49), Expect = 2.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 146 KAANAVTPTVELRKDGDEYNLXXSST 223 K VTPT + GD+ N +ST Sbjct: 89 KTGTGVTPTSSIASSGDDTNSSNNST 114 >AY341161-1|AAR13725.1| 159|Anopheles gambiae CED6 protein. Length = 159 Score = 22.2 bits (45), Expect = 7.7 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = +2 Query: 146 KAANAVTPTVELRKDGDEYNLXXSST 223 K TPT + GD+ N +ST Sbjct: 89 KTGTGATPTSSIASSGDDTNSSNNST 114 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 323,782 Number of Sequences: 2352 Number of extensions: 5014 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33777477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -