BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0728 (305 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding pr... 23 2.6 AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. 23 3.4 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 22 4.5 >AY146729-1|AAO12089.1| 156|Anopheles gambiae odorant-binding protein AgamOBP5 protein. Length = 156 Score = 23.0 bits (47), Expect = 2.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 46 AAPRSCWW 23 AA RSCWW Sbjct: 2 AASRSCWW 9 >AF295693-1|AAL55241.1| 786|Anopheles gambiae polyprotein protein. Length = 786 Score = 22.6 bits (46), Expect = 3.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -3 Query: 126 AGAPQHHTAESVVERVLRSDHADVLGPLHPDPVGG 22 A +P A VL H+DV GP+ +GG Sbjct: 323 ARSPFPPVAGKTSTEVLDIIHSDVCGPMEETTLGG 357 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -3 Query: 99 ESVVERVLRSDHADVLGPLHPDPVGGEXVXL 7 E RVL H D+ GP++ GG L Sbjct: 67 ERQTTRVLDLVHTDICGPMNTVTSGGSRYFL 97 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 245,280 Number of Sequences: 2352 Number of extensions: 3470 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19992474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -