BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0725 (436 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_1107 + 10205351-10207519 28 3.8 04_04_0447 - 25297351-25297575,25297663-25298370,25298824-252991... 28 3.8 07_01_1105 - 10173039-10173156,10173715-10173716,10174550-101745... 27 5.0 06_02_0361 - 15168735-15168754,15168783-15169248 27 5.0 >07_01_1107 + 10205351-10207519 Length = 722 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 52 LMRTPGSMXLIVVFRYLRLEN*SIQLSPYAVG 147 ++ P S+ ++ RYL L+N IQ+ P +VG Sbjct: 621 IVEVPKSIGSLIHLRYLGLDNTGIQMLPESVG 652 >04_04_0447 - 25297351-25297575,25297663-25298370,25298824-25299123, 25299876-25299927,25300530-25300673,25301002-25301258, 25301533-25301739,25301819-25301992,25302409-25302432, 25302610-25302677,25304607-25304665,25304802-25304877, 25304965-25305070,25305268-25305377,25305831-25305995, 25306571-25306656,25306893-25306957,25307280-25307330, 25309009-25309056,25309677-25309796,25310226-25310301, 25310780-25310877,25312149-25312404,25313117-25313238 Length = 1198 Score = 27.9 bits (59), Expect = 3.8 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = +2 Query: 209 HLI*YPDPLMTMPIKQNSK*YCAVTIL 289 H + +PDP+ + I +++K YC +++L Sbjct: 296 HDVEFPDPMPVVGISRSAKGYCLISVL 322 >07_01_1105 - 10173039-10173156,10173715-10173716,10174550-10174584, 10174696-10174765,10175163-10176707,10176770-10178062 Length = 1020 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 52 LMRTPGSMXLIVVFRYLRLEN*SIQLSPYAVG 147 ++ P S+ ++ RYL L+N IQ+ P +VG Sbjct: 605 IVEVPKSIGSLIHLRYLGLDNTRIQMLPESVG 636 >06_02_0361 - 15168735-15168754,15168783-15169248 Length = 161 Score = 27.5 bits (58), Expect = 5.0 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 271 LCRDNSYIIVLINRRYNIFLKITFLMWKLCRSL 369 LC ++++++VLI+ + TF+ K C+SL Sbjct: 124 LCENHNHLMVLISNMIRSVVVDTFIYHKYCKSL 156 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,675,273 Number of Sequences: 37544 Number of extensions: 123897 Number of successful extensions: 146 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 145 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 146 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 826450812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -