BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0725 (436 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40140| Best HMM Match : SASP_gamma (HMM E-Value=0.36) 27 8.8 SB_7632| Best HMM Match : Hin1 (HMM E-Value=4.7) 27 8.8 >SB_40140| Best HMM Match : SASP_gamma (HMM E-Value=0.36) Length = 704 Score = 26.6 bits (56), Expect = 8.8 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Frame = -3 Query: 275 HNIIC-YFVLLALSSKDRDIKLNVLKT*NKFTSK 177 H +I Y VLL SK RDI + V+ + FTS+ Sbjct: 38 HGVIKNYEVLLKRGSKQRDINIPVIASSGSFTSE 71 >SB_7632| Best HMM Match : Hin1 (HMM E-Value=4.7) Length = 158 Score = 26.6 bits (56), Expect = 8.8 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = -3 Query: 347 IKNVILRNILYLLFINTII*ELSRHNIICYFVLLALSSKDRDIKLN 210 I N+I+ NI+ ++ IN II + +NII ++ ++ +I +N Sbjct: 20 INNIIINNII-IIIINNIIIIIIINNIIIIIIIKIINITINNITIN 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,287,029 Number of Sequences: 59808 Number of extensions: 155683 Number of successful extensions: 193 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 834771332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -