BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0725 (436 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK074686-1|BAC11138.1| 143|Homo sapiens protein ( Homo sapiens ... 31 1.7 CR533511-1|CAG38542.1| 344|Homo sapiens ZDHHC4 protein. 31 2.3 BC001239-1|AAH01239.1| 344|Homo sapiens ZDHHC4 protein protein. 31 2.3 AY359090-1|AAQ89448.1| 344|Homo sapiens ZDHHC4 protein. 31 2.3 AK223532-1|BAD97252.1| 344|Homo sapiens zinc finger, DHHC domai... 31 2.3 AK001341-1|BAA91636.1| 344|Homo sapiens protein ( Homo sapiens ... 31 2.3 AF201931-1|AAF86867.1| 344|Homo sapiens DC1 protein. 31 2.3 >AK074686-1|BAC11138.1| 143|Homo sapiens protein ( Homo sapiens cDNA FLJ90205 fis, clone MAMMA1001957, highly similar to Minor histocompatibility antigen 13 isoform 4. ). Length = 143 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -1 Query: 211 MF*KHRINLLQNTYFYALTIYYLLHTVITELISFQ 107 +F + INLL + YF+ L I L HT+ +E IS Q Sbjct: 95 IFSQEYINLLLSMYFFVLGILALSHTIRSEGISLQ 129 >CR533511-1|CAG38542.1| 344|Homo sapiens ZDHHC4 protein. Length = 344 Score = 30.7 bits (66), Expect = 2.3 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -3 Query: 383 HYLFHKLRHSFHIKNVILRNILYLLFINTII-----*ELSRHNIICYFVLLALS 237 HYLFH H+F + +++L+ ++Y + + ELS H ++ ++LL ++ Sbjct: 58 HYLFHTRNHTFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVN 111 >BC001239-1|AAH01239.1| 344|Homo sapiens ZDHHC4 protein protein. Length = 344 Score = 30.7 bits (66), Expect = 2.3 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -3 Query: 383 HYLFHKLRHSFHIKNVILRNILYLLFINTII-----*ELSRHNIICYFVLLALS 237 HYLFH H+F + +++L+ ++Y + + ELS H ++ ++LL ++ Sbjct: 58 HYLFHTRNHTFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVN 111 >AY359090-1|AAQ89448.1| 344|Homo sapiens ZDHHC4 protein. Length = 344 Score = 30.7 bits (66), Expect = 2.3 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -3 Query: 383 HYLFHKLRHSFHIKNVILRNILYLLFINTII-----*ELSRHNIICYFVLLALS 237 HYLFH H+F + +++L+ ++Y + + ELS H ++ ++LL ++ Sbjct: 58 HYLFHTRNHTFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVN 111 >AK223532-1|BAD97252.1| 344|Homo sapiens zinc finger, DHHC domain containing 4 variant protein. Length = 344 Score = 30.7 bits (66), Expect = 2.3 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -3 Query: 383 HYLFHKLRHSFHIKNVILRNILYLLFINTII-----*ELSRHNIICYFVLLALS 237 HYLFH H+F + +++L+ ++Y + + ELS H ++ ++LL ++ Sbjct: 58 HYLFHTRNHTFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVN 111 >AK001341-1|BAA91636.1| 344|Homo sapiens protein ( Homo sapiens cDNA FLJ10479 fis, clone NT2RP2000120. ). Length = 344 Score = 30.7 bits (66), Expect = 2.3 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -3 Query: 383 HYLFHKLRHSFHIKNVILRNILYLLFINTII-----*ELSRHNIICYFVLLALS 237 HYLFH H+F + +++L+ ++Y + + ELS H ++ ++LL ++ Sbjct: 58 HYLFHTRNHTFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVN 111 >AF201931-1|AAF86867.1| 344|Homo sapiens DC1 protein. Length = 344 Score = 30.7 bits (66), Expect = 2.3 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -3 Query: 383 HYLFHKLRHSFHIKNVILRNILYLLFINTII-----*ELSRHNIICYFVLLALS 237 HYLFH H+F + +++L+ ++Y + + ELS H ++ ++LL ++ Sbjct: 58 HYLFHTRNHTFIVLHLVLQGMVYTEYTWEVFGYCQELELSLHYLLLPYLLLGVN 111 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,309,531 Number of Sequences: 237096 Number of extensions: 777663 Number of successful extensions: 550 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 550 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3487985734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -