BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0722 (433 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY089607-1|AAL90345.1| 539|Drosophila melanogaster RE21692p pro... 54 8e-08 AE014296-2102|AAF49952.1| 539|Drosophila melanogaster CG5642-PA... 54 8e-08 >AY089607-1|AAL90345.1| 539|Drosophila melanogaster RE21692p protein. Length = 539 Score = 54.0 bits (124), Expect = 8e-08 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = +3 Query: 90 RSRTTKLSPAEIEAL--NTENKAWNVLCILNVLHSLVDKSNIKRQLE 224 R+R T+ S EI+ L N N+ W++LCILNVLHSLVD SNIK+QLE Sbjct: 171 RARLTEKSQDEIQQLCVNHSNE-WSILCILNVLHSLVDISNIKKQLE 216 >AE014296-2102|AAF49952.1| 539|Drosophila melanogaster CG5642-PA protein. Length = 539 Score = 54.0 bits (124), Expect = 8e-08 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 2/47 (4%) Frame = +3 Query: 90 RSRTTKLSPAEIEAL--NTENKAWNVLCILNVLHSLVDKSNIKRQLE 224 R+R T+ S EI+ L N N+ W++LCILNVLHSLVD SNIK+QLE Sbjct: 171 RARLTEKSQDEIQQLCVNHSNE-WSILCILNVLHSLVDISNIKKQLE 216 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,416,699 Number of Sequences: 53049 Number of extensions: 301459 Number of successful extensions: 520 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 24,988,368 effective HSP length: 78 effective length of database: 20,850,546 effective search space used: 1355285490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -