BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0721 (421 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC428.19c |||U3 snoRNP protein Utp15 |Schizosaccharomyces pomb... 25 6.3 SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting pro... 24 8.4 >SPBC428.19c |||U3 snoRNP protein Utp15 |Schizosaccharomyces pombe|chr 2|||Manual Length = 494 Score = 24.6 bits (51), Expect = 6.3 Identities = 11/50 (22%), Positives = 22/50 (44%) Frame = +3 Query: 255 YSMADGAKEKLRGICKNIHIECYKEETQFAPENASGIXLTXQXVLRLHSG 404 + + + +++LR K + CY + EN S + + + LH G Sbjct: 357 FYVEEARRKRLRPFDKALKSFCYSDALDMVLENGSPVLIITMLIELLHVG 406 >SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting protein 3 homolog Bud6|Schizosaccharomyces pombe|chr 1|||Manual Length = 1385 Score = 24.2 bits (50), Expect = 8.4 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -2 Query: 249 FNRQTASYIAPAVHSGDFAPPRHVGGLHVP*GRHLHRHVTTTLREIPSSMY 97 F Q A+ HSG+ + +H + L HV TT E PSS + Sbjct: 863 FKEQDANKKREDFHSGEVSAIQHSSAQNT-----LDDHVNTTTHESPSSAF 908 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,705,676 Number of Sequences: 5004 Number of extensions: 31021 Number of successful extensions: 54 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 54 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 54 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 148351622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -