BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0719 (426 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59483| Best HMM Match : DUF402 (HMM E-Value=3.8) 27 6.5 SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25) 27 8.6 >SB_59483| Best HMM Match : DUF402 (HMM E-Value=3.8) Length = 796 Score = 27.1 bits (57), Expect = 6.5 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +2 Query: 224 SNHSN*LDNTSGDDTSSNVRRLCRKAAYPIPIDI 325 SN + LD TS D + RLCR Y P+D+ Sbjct: 619 SNSTVALDKTSLDGLNEYFGRLCRDDNYTKPVDL 652 >SB_58477| Best HMM Match : Ion_trans (HMM E-Value=1.2e-25) Length = 578 Score = 26.6 bits (56), Expect = 8.6 Identities = 10/34 (29%), Positives = 23/34 (67%) Frame = -3 Query: 121 KGISSIVSKIARTISWISKLLLKFYFLNCVISKI 20 KG+ ++V+ + R++ ++ +L+ F F CV++ I Sbjct: 199 KGLRAMVNSLLRSLKLLTDVLVLFLFSLCVLALI 232 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,209,224 Number of Sequences: 59808 Number of extensions: 188277 Number of successful extensions: 314 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 314 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -