BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0715 (432 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 23 1.9 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 3.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 4.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 4.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 4.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 4.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 4.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 4.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 4.5 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 4.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 4.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 4.5 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 4.5 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 21 4.5 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 4.5 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 4.5 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 21 4.5 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 7.8 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 7.8 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 7.8 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 7.8 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 7.8 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 7.8 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 7.8 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 7.8 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 7.8 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 7.8 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 7.8 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 7.8 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 7.8 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 22.6 bits (46), Expect = 1.9 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -1 Query: 165 RWEISRFHTRC--LGKLSS*SCSPVSARGRCLRE*LQQS 55 RW++ +FH C +G S S V A GR E Q++ Sbjct: 186 RWDLGKFHRVCTQIGS-SMKSVGEVMAIGRKFEEAFQKA 223 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 3.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 236 VLDLHHVTFQFVFS*RAF 183 + D HVTF+ F RAF Sbjct: 170 LFDTVHVTFKLTFDNRAF 187 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 220 YSRERSCSRDRNREYKEKDRRYEKLH 245 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLH 256 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLH 256 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLH 256 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLH 256 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLH 256 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 220 YSRERSCSRDRNREYRKKDRRYEKLH 245 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYKEKDRRYEKLH 256 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYKEKDRRYEKLH 256 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLH 256 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 236 YSRERSCSRDRNREYRKKDRRYEKLH 261 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYKKKDRRYEKLH 256 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYRKKDRRYEKLH 256 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYKEKDRRYEKLH 256 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 21.4 bits (43), Expect = 4.5 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -2 Query: 428 FSCHRICSCKRWRSYYSQSPRLELIH 351 +S R CS R R Y + R E +H Sbjct: 231 YSRERSCSRDRNREYREKDRRYEKLH 256 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 2 RSCSRDRSREYKKKDRRYDQLHNV 25 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 2 RSCSRDRSREYKKKDRRYDQLHNV 25 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 2 RSCSRDRSREYKKKDRRYDQLHNV 25 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 2 RSCSRDRSREYKKKDRRYDQLHNV 25 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 2 RSCSRDRSREYKKKDRRYDQLHNV 25 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 2 RSCSRDRSREYKKKDRRYDQLHNV 25 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 251 RSCSRDRSREYKKKDRRYDQLHNV 274 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 251 RSCSRDRSREYKKKDRRYDQLHNV 274 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 251 RSCSRDRSREYKKKDRRYDQLHNV 274 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 251 RSCSRDRSREYKKKDRRYDQLHNV 274 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 251 RSCSRDRSREYKKKDRRYDQLHNV 274 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 251 RSCSRDRSREYKKKDRRYDQLHNV 274 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 20.6 bits (41), Expect = 7.8 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 416 RICSCKRWRSYYSQSPRLELIHRV 345 R CS R R Y + R + +H V Sbjct: 251 RSCSRDRSREYKKKDRRYDQLHNV 274 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,715 Number of Sequences: 438 Number of extensions: 2249 Number of successful extensions: 44 Number of sequences better than 10.0: 30 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11244597 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -