BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0715 (432 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g58070.1 68418.m07267 lipocalin, putative similar to temperat... 40 5e-04 At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative... 31 0.44 At1g59560.1 68414.m06698 expressed protein contains similarity t... 30 0.78 At1g08550.1 68414.m00948 violaxanthin de-epoxidase precursor, pu... 29 1.0 At5g60040.1 68418.m07529 DNA-directed RNA polymerase, putative s... 28 2.4 At5g49110.1 68418.m06079 expressed protein ; expression support... 27 7.2 At5g37100.1 68418.m04453 replication protein-related weak simila... 27 7.2 At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochro... 27 7.2 At2g14800.1 68415.m01677 hypothetical protein 27 7.2 At3g05150.1 68416.m00559 sugar transporter family protein simila... 26 9.6 >At5g58070.1 68418.m07267 lipocalin, putative similar to temperature stress-induced lipocalin [Triticum aestivum] GI:18650668 Length = 186 Score = 40.3 bits (90), Expect = 5e-04 Identities = 23/64 (35%), Positives = 33/64 (51%), Gaps = 2/64 (3%) Frame = +3 Query: 90 ELKPVNNFNLTAYQGIWYEISKFPNESE-KNGKCSSAEYKLEGD-VVKVKNVHIIDGSRS 263 E++ V N+ Y G WYEI+ FP+ + KNG + A Y L D + V N +G R Sbjct: 6 EMEVVKGLNVERYMGRWYEIASFPSRFQPKNGVDTRATYTLNPDGTIHVLNETWSNGKRG 65 Query: 264 I*KG 275 +G Sbjct: 66 FIEG 69 >At5g17000.1 68418.m01991 NADP-dependent oxidoreductase, putative strong similarity to probable NADP-dependent oxidoreductase (zeta-crystallin homolog) P1 [SP|Q39172][gi:886428] and P2 [SP|Q39173][gi:886430], Arabidopsis thaliana Length = 345 Score = 30.7 bits (66), Expect = 0.44 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = +3 Query: 147 ISKFPNESEKNGKCSSAEYKLEG--DVVKVKNVHI-IDGSRSI*KGRPSSPTTPI 302 +S FP ES+ + K ++ E+KL G + V VKN+++ D I G+P T + Sbjct: 14 VSGFPKESDFDFKTTTVEFKLPGGSNSVLVKNLYLSCDPYMRIRMGKPDPSTAAL 68 >At1g59560.1 68414.m06698 expressed protein contains similarity to apoptosis inhibitors Length = 338 Score = 29.9 bits (64), Expect = 0.78 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +1 Query: 169 LRRTANALQLNTNWKVTW*RSRTCISSTAQEV--YRRDG 279 L+RTA L NW+ +W R+ T + +EV Y DG Sbjct: 78 LKRTAEQQVLRRNWRFSWVRNSTLMQPMTKEVPWYLDDG 116 >At1g08550.1 68414.m00948 violaxanthin de-epoxidase precursor, putative (AVDE1) similar to EST gb|N37612 Length = 462 Score = 29.5 bits (63), Expect = 1.0 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +3 Query: 102 VNNFNLTAYQGIWYEISKFPNESEKNGKCSSAEYKLEGDVVKVKNV 239 V NFN++ + G WY I+ N + C E+ EGD V N+ Sbjct: 204 VQNFNISDFNGKWY-ITSGLNPTFDAFDCQLHEFHTEGDNKLVGNI 248 >At5g60040.1 68418.m07529 DNA-directed RNA polymerase, putative similar to SP|P04051 DNA-directed RNA polymerase III largest subunit (EC 2.7.7.6) {Saccharomyces cerevisiae}; contains InterPro accession IPR000722: RNA polymerase, alpha subunit Length = 1328 Score = 28.3 bits (60), Expect = 2.4 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +2 Query: 263 YIEGTAKLTDDANKAAKLTVTFKFGEISRDGSVQVLATDYNNYAIA 400 Y + ++ KA F G ++DG +L DYN++A A Sbjct: 609 YFRNSELISGQLGKATLALDIFPLGNGNKDGLYSILLRDYNSHAAA 654 >At5g49110.1 68418.m06079 expressed protein ; expression supported by MPSS Length = 1487 Score = 26.6 bits (56), Expect = 7.2 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 329 KFGEISRDGSVQVLATDYNNYAIAYNCKY 415 KFGE S L T YN+Y ++ +CK+ Sbjct: 321 KFGESSLGMLRTALLTAYNDYRLSKDCKW 349 >At5g37100.1 68418.m04453 replication protein-related weak similarity to Replication Protein A 70 kDa DNA-binding subunit (RP-A) (RF-A) (Replication factor-A protein 1) (Single-stranded DNA-binding protein) (DMRPA1) (GI:2498844)(SP:Q24492) [Drosophila melanogaster] Length = 269 Score = 26.6 bits (56), Expect = 7.2 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = +3 Query: 102 VNNFNLTAYQGIWYEISKFP-NESEKNGKCSSAEYKLE 212 +NNF + ++G WY I+ F + K SS Y++E Sbjct: 60 LNNFKPSLFEGKWYYIADFRLKRATSIPKYSSFNYEIE 97 >At4g11110.1 68417.m01803 WD-40 repeat family protein / phytochrome A-related contains 7 WD-40 repeats (PF00400); similar to phytochrome A supressor spa1 (GI:4809171) [Arabidopsis thaliana]; contains non-consensus (GC) donor splice sites at introns 4 and 6 Length = 1017 Score = 26.6 bits (56), Expect = 7.2 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +3 Query: 177 NGKCSSAEYKL-EGDVVKVKNVHIIDGSRSI*KGRPSS 287 N CSS + EGDVV+ V +GS GRPSS Sbjct: 77 NEPCSSRQNTNDEGDVVEELTVKTCEGSSMAIVGRPSS 114 >At2g14800.1 68415.m01677 hypothetical protein Length = 580 Score = 26.6 bits (56), Expect = 7.2 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +1 Query: 130 KASGMKSRNFPTNLRRTANALQLNTNWKVTW*RSRTC--ISSTAQEV 264 K G+KS F N + + N W TW R TC I S EV Sbjct: 175 KLKGLKSWMFKYNFEKRILEKRHNRGWLHTWSRRVTCRKIKSAKLEV 221 >At3g05150.1 68416.m00559 sugar transporter family protein similar to sugar-porter family proteins 1 and 2 [Arabidopsis thaliana] GI:14585699, GI:14585701; contains Pfam profile PF00083: major facilitator superfamily protein Length = 470 Score = 26.2 bits (55), Expect = 9.6 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 148 SRNFPTNLRRTANALQLNTNWKVTW 222 S FP NL+ TA L NW +W Sbjct: 394 SEIFPINLKGTAGGLVTVVNWLSSW 418 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,103,596 Number of Sequences: 28952 Number of extensions: 145230 Number of successful extensions: 397 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 685039728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -