BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0712 (433 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025724-1|AAG23375.2| 4177|Caenorhabditis elegans Enhancer of e... 28 3.3 Z83106-1|CAB05493.1| 359|Caenorhabditis elegans Hypothetical pr... 27 7.7 >AC025724-1|AAG23375.2| 4177|Caenorhabditis elegans Enhancer of efl-1 mutant phenotypeprotein 1 protein. Length = 4177 Score = 27.9 bits (59), Expect = 3.3 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +3 Query: 75 QNAPGH*YVSGKSLEKIEKIQLTKLSEIKFDHKITSCVLVLTTLHCISL 221 Q+ P H + S ++ + + ++ + +K HK C ++ T+HC+ L Sbjct: 2233 QSCPAHHHHHHSSTDRNNRERSSQNAIMKMFHKKRMCADLVKTIHCLQL 2281 >Z83106-1|CAB05493.1| 359|Caenorhabditis elegans Hypothetical protein F22B8.1 protein. Length = 359 Score = 26.6 bits (56), Expect = 7.7 Identities = 13/23 (56%), Positives = 16/23 (69%) Frame = +3 Query: 171 KITSCVLVLTTLHCISLMIQYIF 239 K S +L+LTTL ISL+I IF Sbjct: 209 KSWSAILILTTLSVISLVINSIF 231 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,617,092 Number of Sequences: 27780 Number of extensions: 148887 Number of successful extensions: 359 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 355 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 359 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 724655464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -