Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0710
         (428 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase doma...    23   1.9  

>DQ067178-1|AAZ20250.1|  448|Apis mellifera conserved ATPase domain
           protein protein.
          Length = 448

 Score = 22.6 bits (46), Expect = 1.9
 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%)
 Frame = -2

Query: 178 RWEISRFHTRC--LGKLSS*SCSPVSARGRCLRE*LQQS 68
           RW++ +FH  C  +G  S  S   V A GR   E  Q++
Sbjct: 186 RWDLGKFHRVCTQIGS-SMKSVGEVMAIGRKFEEAFQKA 223


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 102,179
Number of Sequences: 438
Number of extensions: 2130
Number of successful extensions: 8
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 11121030
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)