BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0707 (429 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subuni... 27 1.2 SPAC13G6.03 |gpi7||GPI anchor biosynthesis protein Gpi7 |Schizos... 25 5.0 >SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subunit a Pol2 |Schizosaccharomyces pombe|chr 2|||Manual Length = 2199 Score = 27.1 bits (57), Expect = 1.2 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 296 SWCLYFNYFTGFVYSLCNRVPNVP 367 ++ LY Y F++SLCN +P P Sbjct: 467 TYFLYMKYVHPFIFSLCNIIPLNP 490 >SPAC13G6.03 |gpi7||GPI anchor biosynthesis protein Gpi7 |Schizosaccharomyces pombe|chr 1|||Manual Length = 758 Score = 25.0 bits (52), Expect = 5.0 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +3 Query: 78 VHQNRLMIKF*FSFIDEDPCIWSYTKKKSEILLFVNKRSK 197 V QN ++I F SFI+E+ IW + +L +N +++ Sbjct: 438 VVQN-IIIVFSSSFIEEEHVIWYFAAVSLSLLQLLNPKTR 476 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,723,654 Number of Sequences: 5004 Number of extensions: 33099 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 154448264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -