BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0707 (429 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40823| Best HMM Match : rve (HMM E-Value=1.4e-12) 27 5.0 SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12) 27 6.6 >SB_40823| Best HMM Match : rve (HMM E-Value=1.4e-12) Length = 651 Score = 27.5 bits (58), Expect = 5.0 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +1 Query: 118 SSTKTLAFGVTRKKKVKSCYLSTSVQSSREKTIYESFFLKFH*IPV 255 ++ K AFG K V CY+ T VQ + E + ++ + P+ Sbjct: 77 TALKLRAFGGNHLKTVGKCYIDTLVQGRKSPIAVEYYIVEHNVRPI 122 >SB_8862| Best HMM Match : rve (HMM E-Value=3.3e-12) Length = 1358 Score = 27.1 bits (57), Expect = 6.6 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 121 STKTLAFGVTRKKKVKSCYLSTSVQSSREKTIYESFFLKFH*IPV 255 S K AFG K V CY+ T VQ E + ++ + P+ Sbjct: 423 SLKLRAFGGNPLKTVGKCYIDTLVQGQESPIAVEYYIVEHNVRPI 467 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,093,292 Number of Sequences: 59808 Number of extensions: 214196 Number of successful extensions: 340 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -