BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0707 (429 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40945-4|AAA81722.2| 318|Caenorhabditis elegans Hypothetical pr... 27 5.7 AC025726-9|AAK73924.1| 594|Caenorhabditis elegans Hypothetical ... 26 10.0 >U40945-4|AAA81722.2| 318|Caenorhabditis elegans Hypothetical protein F10D7.4 protein. Length = 318 Score = 27.1 bits (57), Expect = 5.7 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +3 Query: 114 SFIDEDPCIWSYTKKKSEILLFVNKRSKQS 203 SFI E PC+W+ K+K I F+ K ++ Sbjct: 220 SFIIEPPCVWAGNKQKG-IFRFIVKLENEA 248 >AC025726-9|AAK73924.1| 594|Caenorhabditis elegans Hypothetical protein Y71G12B.23a protein. Length = 594 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 4/39 (10%) Frame = +3 Query: 222 VFFFKVSLNSRFFHNSWGIFNIL--NCH--GVFILIISP 326 VFFFK+ F H W +F +L +CH V+ ++ P Sbjct: 547 VFFFKLDGIVAFAHAIWHLFVLLGASCHTYAVYAFLLGP 585 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,387,177 Number of Sequences: 27780 Number of extensions: 180478 Number of successful extensions: 350 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 350 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 713998766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -