BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0684 (428 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025726-12|AAK73914.3| 243|Caenorhabditis elegans Ubiquitin co... 29 1.9 U80436-7|AAC71109.1| 1638|Caenorhabditis elegans Uncoordinated p... 28 2.5 U80436-5|AAT68892.1| 2140|Caenorhabditis elegans Uncoordinated p... 28 2.5 U80436-1|AAC71108.1| 2488|Caenorhabditis elegans Uncoordinated p... 28 2.5 AF048835-1|AAC12932.1| 1638|Caenorhabditis elegans guanine nucle... 28 2.5 AF048834-1|AAC12931.1| 2488|Caenorhabditis elegans guanine nucle... 28 2.5 >AC025726-12|AAK73914.3| 243|Caenorhabditis elegans Ubiquitin conjugating enzyme protein3 protein. Length = 243 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +3 Query: 354 SNTVPTSSALRALALEYKSLQEEPV 428 S +S ALRAL +E K+LQ +PV Sbjct: 3 SKASTSSGALRALTMELKNLQSQPV 27 >U80436-7|AAC71109.1| 1638|Caenorhabditis elegans Uncoordinated protein 73, isoform b protein. Length = 1638 Score = 28.3 bits (60), Expect = 2.5 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -1 Query: 326 FTTY-LNKII*TYHFGTLYAVHVSTGISTRHNNNELEILVNIASILQHPQVRVTHFK 159 +T Y +NK + T AV TGI RH LEI IAS+L P R+T ++ Sbjct: 1298 YTEYCVNKEQKNHVIATPDAVSFFTGIRERHG---LEINNEIASLLIKPVQRITRYR 1351 >U80436-5|AAT68892.1| 2140|Caenorhabditis elegans Uncoordinated protein 73, isoform f protein. Length = 2140 Score = 28.3 bits (60), Expect = 2.5 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -1 Query: 326 FTTY-LNKII*TYHFGTLYAVHVSTGISTRHNNNELEILVNIASILQHPQVRVTHFK 159 +T Y +NK + T AV TGI RH LEI IAS+L P R+T ++ Sbjct: 1298 YTEYCVNKEQKNHVIATPDAVSFFTGIRERHG---LEINNEIASLLIKPVQRITRYR 1351 >U80436-1|AAC71108.1| 2488|Caenorhabditis elegans Uncoordinated protein 73, isoform a protein. Length = 2488 Score = 28.3 bits (60), Expect = 2.5 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -1 Query: 326 FTTY-LNKII*TYHFGTLYAVHVSTGISTRHNNNELEILVNIASILQHPQVRVTHFK 159 +T Y +NK + T AV TGI RH LEI IAS+L P R+T ++ Sbjct: 1298 YTEYCVNKEQKNHVIATPDAVSFFTGIRERHG---LEINNEIASLLIKPVQRITRYR 1351 >AF048835-1|AAC12932.1| 1638|Caenorhabditis elegans guanine nucleotide exchange factorUNC-73B protein. Length = 1638 Score = 28.3 bits (60), Expect = 2.5 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -1 Query: 326 FTTY-LNKII*TYHFGTLYAVHVSTGISTRHNNNELEILVNIASILQHPQVRVTHFK 159 +T Y +NK + T AV TGI RH LEI IAS+L P R+T ++ Sbjct: 1298 YTEYCVNKEQKNHVIATPDAVSFFTGIRERHG---LEINNEIASLLIKPVQRITRYR 1351 >AF048834-1|AAC12931.1| 2488|Caenorhabditis elegans guanine nucleotide exchange factorUNC-73A protein. Length = 2488 Score = 28.3 bits (60), Expect = 2.5 Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = -1 Query: 326 FTTY-LNKII*TYHFGTLYAVHVSTGISTRHNNNELEILVNIASILQHPQVRVTHFK 159 +T Y +NK + T AV TGI RH LEI IAS+L P R+T ++ Sbjct: 1298 YTEYCVNKEQKNHVIATPDAVSFFTGIRERHG---LEINNEIASLLIKPVQRITRYR 1351 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,640,297 Number of Sequences: 27780 Number of extensions: 187232 Number of successful extensions: 454 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 454 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 713998766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -