BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0683 (405 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC122869-1|AAI22870.1| 470|Homo sapiens G protein-coupled recep... 33 0.36 BC119779-1|AAI19780.1| 470|Homo sapiens G protein-coupled recep... 33 0.36 AY569571-1|AAS76893.1| 470|Homo sapiens G protein-coupled recep... 33 0.36 AB083620-1|BAB89333.1| 470|Homo sapiens putative G-protein coup... 33 0.36 AB065853-1|BAC06071.1| 470|Homo sapiens seven transmembrane hel... 33 0.36 BC131801-1|AAI31802.1| 567|Homo sapiens protein phosphatase 1, ... 29 7.8 AL121889-2|CAM27345.1| 467|Homo sapiens protein phosphatase 1, ... 29 7.8 AL121889-1|CAI19080.1| 567|Homo sapiens protein phosphatase 1, ... 29 7.8 AL031657-2|CAM28212.1| 467|Homo sapiens protein phosphatase 1, ... 29 7.8 AL031657-1|CAI20058.1| 567|Homo sapiens protein phosphatase 1, ... 29 7.8 AF362910-1|AAK52796.1| 567|Homo sapiens CAAX box protein TIMAP ... 29 7.8 AB177855-1|BAD66833.1| 467|Homo sapiens KIAA0823 splice variant... 29 7.8 AB020630-1|BAA74846.2| 578|Homo sapiens KIAA0823 protein protein. 29 7.8 >BC122869-1|AAI22870.1| 470|Homo sapiens G protein-coupled receptor 152 protein. Length = 470 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 182 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKSLHDALCLG 15 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >BC119779-1|AAI19780.1| 470|Homo sapiens G protein-coupled receptor 152 protein. Length = 470 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 182 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKSLHDALCLG 15 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >AY569571-1|AAS76893.1| 470|Homo sapiens G protein-coupled receptor 152 protein. Length = 470 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 182 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKSLHDALCLG 15 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >AB083620-1|BAB89333.1| 470|Homo sapiens putative G-protein coupled receptor protein. Length = 470 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 182 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKSLHDALCLG 15 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >AB065853-1|BAC06071.1| 470|Homo sapiens seven transmembrane helix receptor protein. Length = 470 Score = 33.1 bits (72), Expect = 0.36 Identities = 21/56 (37%), Positives = 27/56 (48%) Frame = -2 Query: 182 VACLQFVHQLFISFRLGETVGSVFLQVLLLLICEGLSQDNADDEHDKSLHDALCLG 15 V CL F +S R+ E +G FL LLLL+C L+Q A + A C G Sbjct: 180 VICLDFWDSEELSLRMLEVLGG-FLPFLLLLVCHVLTQATACRTCHRQQQPAACRG 234 >BC131801-1|AAI31802.1| 567|Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 16B protein. Length = 567 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 90 EQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKTGNSR 269 + E L H A + T DE ++ + +FK LK + +++KSQL K+ SR Sbjct: 276 QMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELK-HKHDVIMKSQLRHKSSLSR 334 Query: 270 RT 275 RT Sbjct: 335 RT 336 >AL121889-2|CAM27345.1| 467|Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 16B protein. Length = 467 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 90 EQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKTGNSR 269 + E L H A + T DE ++ + +FK LK + +++KSQL K+ SR Sbjct: 176 QMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELK-HKHDVIMKSQLRHKSSLSR 234 Query: 270 RT 275 RT Sbjct: 235 RT 236 >AL121889-1|CAI19080.1| 567|Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 16B protein. Length = 567 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 90 EQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKTGNSR 269 + E L H A + T DE ++ + +FK LK + +++KSQL K+ SR Sbjct: 276 QMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELK-HKHDVIMKSQLRHKSSLSR 334 Query: 270 RT 275 RT Sbjct: 335 RT 336 >AL031657-2|CAM28212.1| 467|Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 16B protein. Length = 467 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 90 EQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKTGNSR 269 + E L H A + T DE ++ + +FK LK + +++KSQL K+ SR Sbjct: 176 QMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELK-HKHDVIMKSQLRHKSSLSR 234 Query: 270 RT 275 RT Sbjct: 235 RT 236 >AL031657-1|CAI20058.1| 567|Homo sapiens protein phosphatase 1, regulatory (inhibitor) subunit 16B protein. Length = 567 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 90 EQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKTGNSR 269 + E L H A + T DE ++ + +FK LK + +++KSQL K+ SR Sbjct: 276 QMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELK-HKHDVIMKSQLRHKSSLSR 334 Query: 270 RT 275 RT Sbjct: 335 RT 336 >AF362910-1|AAK52796.1| 567|Homo sapiens CAAX box protein TIMAP protein. Length = 567 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 90 EQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKTGNSR 269 + E L H A + T DE ++ + +FK LK + +++KSQL K+ SR Sbjct: 276 QMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELK-HKHDVIMKSQLRHKSSLSR 334 Query: 270 RT 275 RT Sbjct: 335 RT 336 >AB177855-1|BAD66833.1| 467|Homo sapiens KIAA0823 splice variant 1 protein. Length = 467 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 90 EQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKTGNSR 269 + E L H A + T DE ++ + +FK LK + +++KSQL K+ SR Sbjct: 176 QMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELK-HKHDVIMKSQLRHKSSLSR 234 Query: 270 RT 275 RT Sbjct: 235 RT 236 >AB020630-1|BAA74846.2| 578|Homo sapiens KIAA0823 protein protein. Length = 578 Score = 28.7 bits (61), Expect = 7.8 Identities = 20/62 (32%), Positives = 31/62 (50%) Frame = +3 Query: 90 EQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKTGNSR 269 + E L H A + T DE ++ + +FK LK + +++KSQL K+ SR Sbjct: 287 QMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLLLELK-HKHDVIMKSQLRHKSSLSR 345 Query: 270 RT 275 RT Sbjct: 346 RT 347 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 49,017,179 Number of Sequences: 237096 Number of extensions: 847426 Number of successful extensions: 1904 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1874 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1904 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2985693880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -