Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0676
         (413 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_01_0491 + 3720842-3720958,3721904-3723109                           31   0.28 
12_02_0136 + 14109557-14109661,14109742-14109804                       27   7.8  

>03_01_0491 + 3720842-3720958,3721904-3723109
          Length = 440

 Score = 31.5 bits (68), Expect = 0.28
 Identities = 17/52 (32%), Positives = 25/52 (48%)
 Frame = -2

Query: 259 WSKVSSRGSKVTPRAVVFSAHKGAGCSTEKIFRSQPQAEMLIHEATRTLNFV 104
           WS +  +G KV        A  G GC   K+F S+ +A+   H A  +L F+
Sbjct: 379 WSLIGIKGDKV-------GADHGRGCKLAKVFESKDEAKASTHTAISSLPFM 423


>12_02_0136 + 14109557-14109661,14109742-14109804
          Length = 55

 Score = 26.6 bits (56), Expect = 7.8
 Identities = 8/12 (66%), Positives = 11/12 (91%)
 Frame = +1

Query: 190 PPCEQRILPPVA 225
           PPC +R+LPP+A
Sbjct: 8   PPCRRRLLPPIA 19


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 10,949,739
Number of Sequences: 37544
Number of extensions: 218101
Number of successful extensions: 469
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 463
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 469
length of database: 14,793,348
effective HSP length: 75
effective length of database: 11,977,548
effective search space used: 742607976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)