BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0676 (413 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 30 0.66 SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) 28 2.6 SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) 27 6.1 SB_47705| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 SB_59790| Best HMM Match : VWA (HMM E-Value=0) 27 8.1 SB_27375| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.3e-07) 27 8.1 SB_18883| Best HMM Match : DUF734 (HMM E-Value=8.4) 27 8.1 SB_12109| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 30.3 bits (65), Expect = 0.66 Identities = 14/23 (60%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +1 Query: 271 DKDKFQV-NLDVQHFAPEEISVK 336 D DKFQ+ LDV+ F PEEI+ K Sbjct: 2 DADKFQIATLDVREFKPEEITCK 24 Score = 28.3 bits (60), Expect = 2.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 271 DKDKFQVNLDVQHFAPEEISVK 336 D KF + LDV F PEE+ VK Sbjct: 96 DDTKFTLALDVSDFKPEEVDVK 117 >SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) Length = 259 Score = 28.3 bits (60), Expect = 2.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 271 DKDKFQVNLDVQHFAPEEISVK 336 D KF + LDV F PEE+ VK Sbjct: 24 DDTKFTLALDVSDFKPEEVDVK 45 >SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) Length = 189 Score = 27.1 bits (57), Expect = 6.1 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 265 KSDKDKFQVNLDVQHFAPEEISVK 336 K+ +DKF + +DV F PE I V+ Sbjct: 92 KAKEDKFSMAIDVAGFPPESIKVQ 115 >SB_47705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 27.1 bits (57), Expect = 6.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 410 PRYVTMLDLSSPRVCLQPRCSRSAVLTEISSGAKCW 303 P +V L+S V + RSA+ T +S+ +K W Sbjct: 166 PHHVPEYQLASSHVEKSSQAQRSAIYTHVSAPSKVW 201 >SB_59790| Best HMM Match : VWA (HMM E-Value=0) Length = 4151 Score = 26.6 bits (56), Expect = 8.1 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +3 Query: 90 RGYLITKLSVLVASWINISA 149 RG L T+ S+ +A+WIN+ A Sbjct: 2837 RGRLDTRRSITIAAWINVRA 2856 >SB_27375| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.3e-07) Length = 240 Score = 26.6 bits (56), Expect = 8.1 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +1 Query: 262 IKSDKDKFQVNLDVQHFAPEEISVKTADRLHRG 360 +K DK K+Q N D HF P+EI V L+ G Sbjct: 131 LKWDKAKYQ-NRDRVHFDPKEIWVPDISLLNNG 162 >SB_18883| Best HMM Match : DUF734 (HMM E-Value=8.4) Length = 204 Score = 26.6 bits (56), Expect = 8.1 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 338 RRTGYIVVEGKHEEKKDQAWL-HIAV 412 RRTGY VV+G+ AW+ H+ V Sbjct: 146 RRTGYHVVDGEDHTSGSHAWITHLDV 171 >SB_12109| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4085 Score = 26.6 bits (56), Expect = 8.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 60 KSTTTKCR*FRGYLITKLSVLVASWINISAW 152 K + T+ R G LI K++ A WI+ S W Sbjct: 3233 KGSATQARGSLGQLINKMNKPPAKWISASMW 3263 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,114,837 Number of Sequences: 59808 Number of extensions: 229378 Number of successful extensions: 619 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -