BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0674 (436 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC019034-1|AAH19034.1| 213|Homo sapiens FAM79A protein protein. 34 0.18 AL513320-6|CAI14338.1| 213|Homo sapiens family with sequence si... 34 0.18 AL513320-5|CAI14339.1| 272|Homo sapiens family with sequence si... 34 0.18 BC036504-1|AAH36504.3| 680|Homo sapiens chromosome 9 open readi... 29 6.9 AL158826-17|CAI12843.1| 680|Homo sapiens chromosome 9 open read... 29 6.9 AK131545-1|BAD18679.1| 213|Homo sapiens protein ( Homo sapiens ... 29 6.9 AK131533-1|BAD18670.1| 213|Homo sapiens protein ( Homo sapiens ... 29 6.9 >BC019034-1|AAH19034.1| 213|Homo sapiens FAM79A protein protein. Length = 213 Score = 34.3 bits (75), Expect = 0.18 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 291 QTVYP-RYDVPFNKENIKDFFTFRKGVVEAXIQECITILLFPEDGEYLG 434 QT++P P + +K++F FR G +E ++E ++ EDGE G Sbjct: 44 QTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQG 92 >AL513320-6|CAI14338.1| 213|Homo sapiens family with sequence similarity 79, member A protein. Length = 213 Score = 34.3 bits (75), Expect = 0.18 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 291 QTVYP-RYDVPFNKENIKDFFTFRKGVVEAXIQECITILLFPEDGEYLG 434 QT++P P + +K++F FR G +E ++E ++ EDGE G Sbjct: 44 QTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQG 92 >AL513320-5|CAI14339.1| 272|Homo sapiens family with sequence similarity 79, member A protein. Length = 272 Score = 34.3 bits (75), Expect = 0.18 Identities = 16/49 (32%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 291 QTVYP-RYDVPFNKENIKDFFTFRKGVVEAXIQECITILLFPEDGEYLG 434 QT++P P + +K++F FR G +E ++E ++ EDGE G Sbjct: 44 QTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEIQG 92 >BC036504-1|AAH36504.3| 680|Homo sapiens chromosome 9 open reading frame 96 protein. Length = 680 Score = 29.1 bits (62), Expect = 6.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 177 IALGLFSCRICRDTGLIFNNTYR 109 +AL L S R+C+D L+ NN YR Sbjct: 546 VALLLQSIRLCQDRALLVNNAYR 568 >AL158826-17|CAI12843.1| 680|Homo sapiens chromosome 9 open reading frame 96 protein. Length = 680 Score = 29.1 bits (62), Expect = 6.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 177 IALGLFSCRICRDTGLIFNNTYR 109 +AL L S R+C+D L+ NN YR Sbjct: 546 VALLLQSIRLCQDRALLVNNAYR 568 >AK131545-1|BAD18679.1| 213|Homo sapiens protein ( Homo sapiens cDNA FLJ16781 fis, clone BRTHA3004432. ). Length = 213 Score = 29.1 bits (62), Expect = 6.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 177 IALGLFSCRICRDTGLIFNNTYR 109 +AL L S R+C+D L+ NN YR Sbjct: 79 VALLLQSIRLCQDRALLVNNAYR 101 >AK131533-1|BAD18670.1| 213|Homo sapiens protein ( Homo sapiens cDNA FLJ16762 fis, clone BRAMY3016953. ). Length = 213 Score = 29.1 bits (62), Expect = 6.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = -2 Query: 177 IALGLFSCRICRDTGLIFNNTYR 109 +AL L S R+C+D L+ NN YR Sbjct: 79 VALLLQSIRLCQDRALLVNNAYR 101 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 65,186,998 Number of Sequences: 237096 Number of extensions: 1405872 Number of successful extensions: 3112 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3001 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3112 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3487985734 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -