BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0673 (421 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome convers... 26 0.64 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 3.4 >AJ459959-1|CAD31058.1| 462|Anopheles gambiae dopachrome conversion enzyme protein. Length = 462 Score = 25.8 bits (54), Expect = 0.64 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 73 EIPANFIYEDEQCVAFNDVNPQAPTHVLVIPRKPI 177 EIP NF V D+N P H IP++ + Sbjct: 140 EIPGNFTVVQRPSVWSIDLNTNEPIHRFEIPKEAV 174 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.4 bits (48), Expect = 3.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 395 AIXNNLARWPLHLPSSED 342 A + L RW HLP SED Sbjct: 828 ATRSGLLRWIDHLPHSED 845 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 467,954 Number of Sequences: 2352 Number of extensions: 9514 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 34632603 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -