BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0673 (421 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.5 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 20 9.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 7.5 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +3 Query: 261 GLDKTGFRLVVNDGKNGAQSVYHLHIHILGGRQMQWPP 374 GLD G RL + + A + + ++G R+ PP Sbjct: 381 GLDSDGIRLPCREVEAAATARNVVAPFLIGSRRTSPPP 418 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 20.2 bits (40), Expect = 9.9 Identities = 5/12 (41%), Positives = 9/12 (75%) Frame = -1 Query: 232 LEDVLTTVHQCH 197 ++ +L +VH CH Sbjct: 15 IQQILESVHHCH 26 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,758 Number of Sequences: 438 Number of extensions: 2547 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -