Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0673
         (421 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.             21   7.5  
AB013287-1|BAA87893.1|  190|Apis mellifera calmodulin kinase II ...    20   9.9  

>AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein.
          Length = 1598

 Score = 20.6 bits (41), Expect = 7.5
 Identities = 11/38 (28%), Positives = 18/38 (47%)
 Frame = +3

Query: 261 GLDKTGFRLVVNDGKNGAQSVYHLHIHILGGRQMQWPP 374
           GLD  G RL   + +  A +   +   ++G R+   PP
Sbjct: 381 GLDSDGIRLPCREVEAAATARNVVAPFLIGSRRTSPPP 418


>AB013287-1|BAA87893.1|  190|Apis mellifera calmodulin kinase II
           protein.
          Length = 190

 Score = 20.2 bits (40), Expect = 9.9
 Identities = 5/12 (41%), Positives = 9/12 (75%)
 Frame = -1

Query: 232 LEDVLTTVHQCH 197
           ++ +L +VH CH
Sbjct: 15  IQQILESVHHCH 26


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 120,758
Number of Sequences: 438
Number of extensions: 2547
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 52
effective length of database: 123,567
effective search space used: 10750329
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)