BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0670 (434 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC646.05c |erg9||squalene synthase Erg9|Schizosaccharomyces po... 27 1.6 SPBC21B10.07 |||glycosyl hydrolase family 16|Schizosaccharomyces... 26 2.2 SPBC146.05c |cwf25||complexed with Cdc5 protein Cwf25 |Schizosac... 24 8.8 SPAC9G1.12 |cpd1||tRNA |Schizosaccharomyces pombe|chr 1|||Manual 24 8.8 >SPBC646.05c |erg9||squalene synthase Erg9|Schizosaccharomyces pombe|chr 2|||Manual Length = 460 Score = 26.6 bits (56), Expect = 1.6 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 33 FFFLKICIVKLFKVLKLFIHSLYDKNLNLY 122 FF + +C+ +F V + IH K LNL+ Sbjct: 431 FFIILVCLAVIFYVFNIRIHWSDFKELNLF 460 >SPBC21B10.07 |||glycosyl hydrolase family 16|Schizosaccharomyces pombe|chr 2|||Manual Length = 419 Score = 26.2 bits (55), Expect = 2.2 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -1 Query: 431 HACCPWPLLWKTGYDWELKGD 369 + C WP W G DW G+ Sbjct: 217 YGCGTWPAFWTLGDDWPNGGE 237 >SPBC146.05c |cwf25||complexed with Cdc5 protein Cwf25 |Schizosaccharomyces pombe|chr 2|||Manual Length = 376 Score = 24.2 bits (50), Expect = 8.8 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 398 TGYDWELKGDFLLDLNTVCYSDDS 327 T W+ +GDF+ ++ YS DS Sbjct: 336 TARKWDNQGDFIRNMRKEIYSGDS 359 >SPAC9G1.12 |cpd1||tRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 364 Score = 24.2 bits (50), Expect = 8.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 117 LYYVIHLKSQIDKDNFE 167 L + +HL SQ+DK N E Sbjct: 345 LLFAVHLPSQLDKQNQE 361 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,554,176 Number of Sequences: 5004 Number of extensions: 25166 Number of successful extensions: 56 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 56 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 56 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 156095170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -