BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0670 (434 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL110478-8|CAB54342.2| 138|Caenorhabditis elegans Hypothetical ... 27 5.9 AF016441-7|AAB65908.1| 344|Caenorhabditis elegans Hypothetical ... 27 7.8 >AL110478-8|CAB54342.2| 138|Caenorhabditis elegans Hypothetical protein Y26D4A.3 protein. Length = 138 Score = 27.1 bits (57), Expect = 5.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -3 Query: 237 R*NQIHCKHWECLSIFKVIIFILI 166 R I C W C S+ ++IFI++ Sbjct: 80 RNRSISCIEWSCFSVIGLVIFIVV 103 >AF016441-7|AAB65908.1| 344|Caenorhabditis elegans Hypothetical protein M03F8.1 protein. Length = 344 Score = 26.6 bits (56), Expect = 7.8 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 2/37 (5%) Frame = +3 Query: 27 DGFFFLKICIVKLFKVLKLFIHSLYDKN--LNLYYVI 131 D F K+C ++L + LF+++LYD N NL+ V+ Sbjct: 281 DTFVSPKVCFLELACIGILFLNNLYDVNQTQNLHLVV 317 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,390,132 Number of Sequences: 27780 Number of extensions: 134049 Number of successful extensions: 340 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 336 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 735312162 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -