BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0665 (432 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1200 - 35362412-35362432,35362526-35362715,35362799-353628... 29 1.6 >01_06_1200 - 35362412-35362432,35362526-35362715,35362799-35362899, 35362985-35363116,35363204-35363302,35363493-35363568, 35363649-35363941,35364032-35364160,35364332-35364480, 35364562-35364633,35364728-35364776,35365039-35365107, 35365201-35365256,35365357-35365429,35365508-35365584, 35365847-35365934,35366086-35366259,35366358-35366473, 35366681-35366984,35367084-35367146,35367224-35367286, 35367393-35367506,35368672-35368675,35368894-35368952, 35369024-35369098,35369691-35369798,35372331-35372792 Length = 1071 Score = 29.1 bits (62), Expect = 1.6 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -2 Query: 209 LTTNWNGSSVGCPSAPIFLT*PFESNMYPSSFIVFVPS 96 LTT W+ + VGCP+ + + P +S + +PS Sbjct: 51 LTTTWSSAGVGCPTKKLVIVSP-DSELKRGRIYFLIPS 87 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,287,442 Number of Sequences: 37544 Number of extensions: 215088 Number of successful extensions: 437 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 430 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 437 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 814473264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -