BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0664 (435 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11517| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.31 SB_55784| Best HMM Match : CUB (HMM E-Value=3.1e-25) 27 6.7 SB_12004| Best HMM Match : EFG_C (HMM E-Value=1.2e-15) 27 6.7 >SB_11517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 31.5 bits (68), Expect = 0.31 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%) Frame = -1 Query: 330 SLTESKVFGDDDIEVNEVKKTDKYLLKKTII--FDSLVKENTYKLTSNQE 187 ++ ESK D++ K TDK +LK T+I D LV++ +KL +E Sbjct: 49 AIAESKYQQQCDLKSEWEKATDKRILKNTVIRRVDRLVQKEKFKLEDRRE 98 >SB_55784| Best HMM Match : CUB (HMM E-Value=3.1e-25) Length = 418 Score = 27.1 bits (57), Expect = 6.7 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +3 Query: 108 RTVSGCGVSGELFWSFNS-LIRIHFNSTPDSKSICMYF 218 R + G + +L SF++ L+ HF+ + DS S+C+ F Sbjct: 3 RIIFQSGFNNKLTQSFSAKLVGPHFSRSVDSSSVCLRF 40 >SB_12004| Best HMM Match : EFG_C (HMM E-Value=1.2e-15) Length = 549 Score = 27.1 bits (57), Expect = 6.7 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = +3 Query: 36 ALSGFKVRNRSLYRDRSGMYANVSRTVSGCGVSGE 140 +L+GF R + D+S N+S CG+ G+ Sbjct: 265 SLAGFIEERRDIQFDQSAKLPNISSPAGRCGMEGD 299 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,680,112 Number of Sequences: 59808 Number of extensions: 205110 Number of successful extensions: 425 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 394 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 834771332 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -