BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0664 (435 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 2.6 AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase ... 22 3.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 4.5 AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic ac... 21 4.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 6.0 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +3 Query: 48 FKVRNRSLYRDRSGMYANVSRTVSGCGVSGELFWSF 155 F + +R ++R Y N+ T CG+ G + F Sbjct: 346 FYIISRYVFRSALEDYCNIVATHLVCGILGSILVPF 381 >AY855337-1|AAW47987.1| 510|Apis mellifera tyrosine hydroxylase protein. Length = 510 Score = 21.8 bits (44), Expect = 3.4 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 130 TPQPDTVRDTLAYIP 86 TP+PD + + L ++P Sbjct: 331 TPEPDCIHELLGHMP 345 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 4.5 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = -1 Query: 216 NTYKLTSNQECY*NGSVLNY*NSRKVHPTLHNLTQCV 106 NT +L Q NG V+++ N H L +C+ Sbjct: 436 NTERLQVGQYVTVNGDVVSHLNISSTHTNDGGLYKCI 472 >AF514804-1|AAM51823.1| 537|Apis mellifera neuronal nicotinic acetylcholine receptoralpha-3 protein. Length = 537 Score = 21.4 bits (43), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 373 TVPRSFSENIIGALK 329 TVPR S ++I ALK Sbjct: 438 TVPRYLSPDVISALK 452 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 6.0 Identities = 11/23 (47%), Positives = 13/23 (56%), Gaps = 1/23 (4%) Frame = -3 Query: 127 PQ-PDTVRDTLAYIPDRSRYNDL 62 PQ PD +R+ L IPD N L Sbjct: 379 PQHPDILRELLKKIPDLRTLNTL 401 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,309 Number of Sequences: 438 Number of extensions: 1946 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -