BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0650 (375 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC27E2.01 |||alpha-amylase homolog |Schizosaccharomyces pombe|... 27 0.96 SPCC1235.10c |sec6||exocyst complex subunit Sec6|Schizosaccharom... 25 5.1 >SPAC27E2.01 |||alpha-amylase homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 491 Score = 27.1 bits (57), Expect = 0.96 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 4/28 (14%) Frame = +3 Query: 117 FIAKYL-YL---SNYRLEYSKSNTYFSP 188 FIAKYL Y+ +NY L Y NT+F P Sbjct: 253 FIAKYLEYIPSAANYPLYYQIENTFFPP 280 >SPCC1235.10c |sec6||exocyst complex subunit Sec6|Schizosaccharomyces pombe|chr 3|||Manual Length = 730 Score = 24.6 bits (51), Expect = 5.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 108 IXTFIAKYLYLSNYRLEYSKSNTYFSPFXI 197 + T A YLYL N+ EY K +PF + Sbjct: 319 LDTPAAVYLYLINFHREYRKFFEENAPFSV 348 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,102,823 Number of Sequences: 5004 Number of extensions: 16218 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 120195862 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -