BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0643 (435 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 3.4 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 4.5 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 4.5 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 4.5 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 6.0 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 6.0 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 21 7.9 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.8 bits (44), Expect = 3.4 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 17 VCHRLLRWVPTDI 55 VCH + W+PT + Sbjct: 807 VCHNGMNWMPTHL 819 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -3 Query: 187 VFGLCPALWAWERGAYESTD 128 + +C LW W R Y T+ Sbjct: 51 ILPVCNGLWRWIRLTYGQTN 70 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.4 bits (43), Expect = 4.5 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = -3 Query: 187 VFGLCPALWAWERGAYESTD 128 + +C LW W R Y T+ Sbjct: 89 ILPVCNGLWRWIRLTYGQTN 108 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 4.5 Identities = 8/34 (23%), Positives = 14/34 (41%) Frame = +3 Query: 90 YAFFVACESMAVPSVDSYAPRSQAHKAGQSPKTR 191 Y + ++ P+ P H+A + KTR Sbjct: 1213 YTVYTKADNAEEPTSQKVPPNQLTHEASELDKTR 1246 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -3 Query: 181 GLCPALWAWERGAY 140 GLCP++ ++RG + Sbjct: 357 GLCPSMANYDRGVF 370 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 6.0 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -3 Query: 181 GLCPALWAWERGAY 140 GLCP++ ++RG + Sbjct: 447 GLCPSMANYDRGVF 460 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = -1 Query: 138 SQLTVLPYSHTQQKTHNIAQFFPIQLL 58 S + +L Y H TH ++++ + L Sbjct: 311 STILILNYHHRNADTHEMSEWVKVVFL 337 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,395 Number of Sequences: 438 Number of extensions: 2396 Number of successful extensions: 10 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -