BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0639 (429 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory recept... 23 1.6 AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory recept... 23 1.6 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 22 2.8 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 22 2.8 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 5.0 >AM292383-1|CAL23195.2| 320|Tribolium castaneum gustatory receptor candidate 62 protein. Length = 320 Score = 22.6 bits (46), Expect = 1.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 271 FYHLKSIVSFFFLNPEFNKVKENKSLVQFLL 363 FY + S VS FF P ++ ++ LVQ +L Sbjct: 34 FYVVFSSVSTFFKIPFYSTLRPINLLVQIIL 64 >AM292358-1|CAL23170.2| 331|Tribolium castaneum gustatory receptor candidate 37 protein. Length = 331 Score = 22.6 bits (46), Expect = 1.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 271 FYHLKSIVSFFFLNPEFNKVKENKSLVQFLL 363 FY + S VS FF P ++ ++ LVQ +L Sbjct: 34 FYVVFSSVSTFFKIPFYSTLRPINLLVQIIL 64 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.8 bits (44), Expect = 2.8 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = +1 Query: 85 YPPYYEVCVW 114 + PYY +C+W Sbjct: 288 WTPYYVMCIW 297 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 21.8 bits (44), Expect = 2.8 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = +1 Query: 85 YPPYYEVCVW 114 + PYY +C+W Sbjct: 288 WTPYYVMCIW 297 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.0 bits (42), Expect = 5.0 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 152 SKFQGFLYFLLCD 114 S GFL+ L+CD Sbjct: 11 SAIAGFLFLLICD 23 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,513 Number of Sequences: 336 Number of extensions: 2288 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 9460170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -