BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0639 (429 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 24 0.83 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 5.8 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 23.8 bits (49), Expect = 0.83 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -2 Query: 230 RNISVNFIYTRTTSVRLLTYDVTKEWSKFQGFLYFL 123 +NI + I+T + ++ ++ Y + K F F FL Sbjct: 154 KNIGMKRIFTSSQNIAVIEYRIPKSGKGFSLFARFL 189 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 5.8 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 374 TIHSNKNCTNDLFS 333 T+H ++ NDLFS Sbjct: 42 TVHEEESSLNDLFS 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,388 Number of Sequences: 438 Number of extensions: 2364 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11121030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -