BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0636 (434 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 6.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 6.2 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 22.6 bits (46), Expect = 6.2 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = +2 Query: 11 IFILVSRTREFTSNSFFVQNFMAGNALFS 97 +FI+ S R T +FF+ N G+ + + Sbjct: 158 LFIVQSNPRMRTVTNFFITNLAVGDLMMT 186 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 6.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = -3 Query: 120 YRTCLPSKEKSAFPAMKFCTKKLLLVNSRVL 28 +RT PSKE A A+ +LL N R L Sbjct: 1324 FRTSTPSKEDEALGALGPLHHRLLSSNVRSL 1354 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 342,858 Number of Sequences: 2352 Number of extensions: 5656 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36142935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -