BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0634 (434 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 45 1e-06 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 27 0.29 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 25 0.88 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 25 1.5 AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 24 2.0 U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. 24 2.7 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 3.6 DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 23 4.7 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 45.2 bits (102), Expect = 1e-06 Identities = 17/34 (50%), Positives = 27/34 (79%) Frame = -3 Query: 387 VLITTDLLARGIDVQQVSCVINYDLPSNRENYIH 286 VLI T + ARG+D++ V+ V+NYDLP + ++Y+H Sbjct: 476 VLIATSVAARGLDIKNVNHVVNYDLPKSIDDYVH 509 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 27.1 bits (57), Expect = 0.29 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = -3 Query: 387 VLITTDLLARGIDVQQVSCVINYDLPSNRENY 292 +LI T +L GI++ + + VI ++ P+N +Y Sbjct: 614 LLIGTSVLEEGIELPKCNLVIRWNSPANYRSY 645 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 25.4 bits (53), Expect = 0.88 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 53 VSQAQWVDLLINIAIERRTQNINRKNVGALDEVGHI 160 + + + +D+L NI +ER +INR G + +GH+ Sbjct: 350 LDETRGIDVLGNI-LERSAISINRNLYGDVHNMGHV 384 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.6 bits (51), Expect = 1.5 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 165 PVMWPTSSKAPT 130 PV WP SS APT Sbjct: 469 PVSWPVSSDAPT 480 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 24.2 bits (50), Expect = 2.0 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = -1 Query: 404 ELALLVS*SPLIYWHVVLMYSKFPASSTMICHPTVKIIFTGLD 276 E LLV+ L+Y++VV+ ++F A + P V ++ G D Sbjct: 13 EGVLLVALLALLYYYVVVRSTRFFADRGVPYLPPVPLLGNGAD 55 >U43499-1|AAA93302.1| 278|Anopheles gambiae a-emp protein. Length = 278 Score = 23.8 bits (49), Expect = 2.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 85 KYRNRTQDTEYKSEKCRRL 141 KY R+ T + SE+C RL Sbjct: 155 KYNGRSLQTHWLSEQCNRL 173 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.4 bits (48), Expect = 3.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 52 RFTGSVGRSSYKYRNRTQDTEYKS 123 RFT + + +YR DTEY+S Sbjct: 687 RFTSAYQFAVLRYRGAPTDTEYES 710 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 23.0 bits (47), Expect = 4.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 144 SKAPTFFRFIFCVLRSIA 91 SK P F FCVLR IA Sbjct: 108 SKYPYVFGETFCVLRGIA 125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 449,870 Number of Sequences: 2352 Number of extensions: 7978 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36142935 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -