BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0634 (434 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 44 6e-07 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 25 0.37 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 25 0.37 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 25 0.37 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 22 3.4 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 22 3.4 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 22 3.4 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 22 3.4 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 6.0 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 21 6.0 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 21 6.0 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 21 6.0 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 21 6.0 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 21 6.0 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 21 6.0 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 21 6.0 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 6.0 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 6.0 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 6.0 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 6.0 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 21 6.0 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 21 6.0 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 21 6.0 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 6.0 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 6.0 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 6.0 DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 21 7.9 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 44.4 bits (100), Expect = 6e-07 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = -3 Query: 387 VLITTDLLARGIDVQQVSCVINYDLPSNRENYIH 286 +L+ T + ARG+D++ VS VINYDLP + Y+H Sbjct: 504 ILVATAVAARGLDIKNVSHVINYDLPKGIDEYVH 537 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 0.37 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 181 SIVEMPSDVANLI*GAYIFPIYILCPAFYCDI 86 +I+ MP +VA L+ G +IF I++ CD+ Sbjct: 86 AILVMPFNVAYLLLGKWIFGIHLCKLWLTCDV 117 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 0.37 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 181 SIVEMPSDVANLI*GAYIFPIYILCPAFYCDI 86 +I+ MP +VA L+ G +IF I++ CD+ Sbjct: 86 AILVMPFNVAYLLLGKWIFGIHLCKLWLTCDV 117 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 25.0 bits (52), Expect = 0.37 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 181 SIVEMPSDVANLI*GAYIFPIYILCPAFYCDI 86 +I+ MP +VA L+ G +IF I++ CD+ Sbjct: 86 AILVMPFNVAYLLLGKWIFGIHLCKLWLTCDV 117 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 3.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 37 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 3.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 37 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 3.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 37 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 21.8 bits (44), Expect = 3.4 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 37 EVSKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 + S+ R++ S R Y+N + EY+ R R Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERSR 68 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 159 MWPTSSKAPTFFRFIFCVL 103 MW TS + P FF +L Sbjct: 407 MWSTSLRDPVFFSIYKTIL 425 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 35 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 35 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 35 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 35 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 35 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 35 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 35 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 68 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 159 MWPTSSKAPTFFRFIFCVL 103 MW TS + P FF +L Sbjct: 407 MWSTSLRDPVFFSIYKTIL 425 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 284 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 284 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 284 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 284 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 284 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 284 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 283 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 316 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 6.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = +1 Query: 43 SKVRFTGSVGRSSYKYRNRTQDTEYKSEKCRRLR 144 S+ R++ S R Y+N + EY+ R R Sbjct: 284 SRRRYSRSREREQKSYKNEREYREYRETSRERSR 317 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 159 MWPTSSKAPTFFRFIFCVL 103 MW TS + P FF +L Sbjct: 33 MWSTSLRDPVFFSIYKTIL 51 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/34 (23%), Positives = 19/34 (55%) Frame = -2 Query: 124 PIYILCPAFYCDIYKKIYPLSL*NALWILLCGNN 23 P+++L Y D+ +I + + +A+ +C N+ Sbjct: 383 PVFLLXTLNYTDVXFRILTMPVRDAIAGTICENS 416 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,173 Number of Sequences: 438 Number of extensions: 2613 Number of successful extensions: 29 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -