BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0633 (417 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC800.14c |||DUF1772 family protein|Schizosaccharomyces pombe|... 26 2.7 SPBC11C11.05 |||KRE9 family cell wall biosynthesis protein |Schi... 26 2.7 >SPBC800.14c |||DUF1772 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 160 Score = 25.8 bits (54), Expect = 2.7 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +1 Query: 208 ALHNLSGLCVVPYNLL 255 A+ LSGLC++P+ LL Sbjct: 86 AISALSGLCIIPFTLL 101 >SPBC11C11.05 |||KRE9 family cell wall biosynthesis protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 284 Score = 25.8 bits (54), Expect = 2.7 Identities = 8/38 (21%), Positives = 21/38 (55%) Frame = -2 Query: 383 QAALVLMVSFLCSYVKSITARDKYLTPCVLTILPLAVI 270 + ++++V +CSY+ + A+ +++TP + I Sbjct: 2 KTTMLMLVLLVCSYIHYVCAQIRFVTPATTDSMDFTAI 39 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,645,218 Number of Sequences: 5004 Number of extensions: 31615 Number of successful extensions: 60 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 146319408 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -