BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0629 (440 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0578 + 5180538-5181385,5182480-5182595,5183397-5183605,518... 33 0.13 01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902,467... 31 0.31 07_03_0396 + 17672009-17672339,17672408-17673087 27 6.7 >05_01_0578 + 5180538-5181385,5182480-5182595,5183397-5183605, 5184024-5184143,5184247-5184375,5184466-5184591, 5185550-5185667,5186471-5186680,5186788-5187100, 5187467-5187560,5187760-5187868,5188322-5188593, 5188684-5188811,5188977-5189211,5189794-5189982, 5190069-5190349,5190431-5190698,5190719-5190961, 5191598-5191680,5192484-5192493 Length = 1366 Score = 32.7 bits (71), Expect = 0.13 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 159 YQFFKMYLYFFFCILYYNLCWNNKQTNKKKLLYSIRVVVES 281 YQ+++ +Y CIL Y L W+ +Q +++ L +R V S Sbjct: 949 YQWWEGSIYSILCILSYPLAWSWQQWRRRRKLQRLREFVRS 989 >01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902, 4675953-4676072,4676185-4676313,4676394-4676442, 4676899-4676970,4677574-4677707,4677798-4677915, 4678332-4678541,4678630-4678942,4679539-4679632, 4679854-4679962,4680243-4680514,4680597-4680724, 4680832-4681066,4681570-4681758,4681845-4682128, 4682218-4682398,4682486-4682728,4682904-4682986, 4683119-4683227,4687996-4688091,4688675-4688764, 4688881-4689129,4689233-4689412,4690179-4690250, 4691385-4691474,4691605-4691705,4691794-4691959 Length = 1757 Score = 31.5 bits (68), Expect = 0.31 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = +3 Query: 159 YQFFKMYLYFFFCILYYNLCWNNKQTNKKKLLYSIRVVVES 281 YQ+++ ++ C+L Y L W+ +Q ++K L +R V S Sbjct: 987 YQWWEGSIHSILCVLAYPLAWSWQQFRRRKKLQRLREFVRS 1027 >07_03_0396 + 17672009-17672339,17672408-17673087 Length = 336 Score = 27.1 bits (57), Expect = 6.7 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 81 CVVCAYDLTNACVCLMFCRCVHV*TQYQ 164 C C A +CL CRC HV YQ Sbjct: 91 CTRCGIVGHTASLCLPTCRCDHVPKDYQ 118 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,953,802 Number of Sequences: 37544 Number of extensions: 139582 Number of successful extensions: 250 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 250 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 835800280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -