BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0629 (440 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding pr... 23 4.8 AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. 23 6.4 AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. 23 6.4 AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. 23 6.4 AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. 23 6.4 AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 22 8.4 >AY146741-1|AAO12101.1| 131|Anopheles gambiae odorant-binding protein AgamOBP10 protein. Length = 131 Score = 23.0 bits (47), Expect = 4.8 Identities = 8/29 (27%), Positives = 18/29 (62%) Frame = +2 Query: 17 NVHCVATM*TTLRNINTNPLWLCCVRLRF 103 ++HC ++ +L + + +P+W C V+ F Sbjct: 40 SLHCSLSLSLSLLSPSFSPIWQCFVQCFF 68 >AY334000-1|AAR01125.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 22.6 bits (46), Expect = 6.4 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -3 Query: 282 TIPQQHEWNKVV 247 T PQ+H+WN+ + Sbjct: 88 TPPQKHQWNQTI 99 >AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 22.6 bits (46), Expect = 6.4 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -3 Query: 282 TIPQQHEWNKVV 247 T PQ+H+WN+ + Sbjct: 88 TPPQKHQWNQTI 99 >AY333998-1|AAR01123.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 22.6 bits (46), Expect = 6.4 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -3 Query: 282 TIPQQHEWNKVV 247 T PQ+H+WN+ + Sbjct: 88 TPPQKHQWNQTI 99 >AY333997-1|AAR01122.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 22.6 bits (46), Expect = 6.4 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -3 Query: 282 TIPQQHEWNKVV 247 T PQ+H+WN+ + Sbjct: 88 TPPQKHQWNQTI 99 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 22.2 bits (45), Expect = 8.4 Identities = 10/34 (29%), Positives = 21/34 (61%) Frame = -3 Query: 417 LKYFFFLIINFRIMDRMKTYDDAXLKQEDAKS*C 316 ++Y FF++++ DR++ +D+ + DA S C Sbjct: 597 IEYDFFVMVSDFAQDRVEDFDE-NVNCNDAHSFC 629 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 408,868 Number of Sequences: 2352 Number of extensions: 7197 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 36993357 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -