Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0629
         (440 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY146741-1|AAO12101.1|  131|Anopheles gambiae odorant-binding pr...    23   4.8  
AY334000-1|AAR01125.1|  268|Anopheles gambiae FBN23 protein.           23   6.4  
AY333999-1|AAR01124.1|  268|Anopheles gambiae FBN23 protein.           23   6.4  
AY333998-1|AAR01123.1|  268|Anopheles gambiae FBN23 protein.           23   6.4  
AY333997-1|AAR01122.1|  268|Anopheles gambiae FBN23 protein.           23   6.4  
AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase p...    22   8.4  

>AY146741-1|AAO12101.1|  131|Anopheles gambiae odorant-binding
           protein AgamOBP10 protein.
          Length = 131

 Score = 23.0 bits (47), Expect = 4.8
 Identities = 8/29 (27%), Positives = 18/29 (62%)
 Frame = +2

Query: 17  NVHCVATM*TTLRNINTNPLWLCCVRLRF 103
           ++HC  ++  +L + + +P+W C V+  F
Sbjct: 40  SLHCSLSLSLSLLSPSFSPIWQCFVQCFF 68


>AY334000-1|AAR01125.1|  268|Anopheles gambiae FBN23 protein.
          Length = 268

 Score = 22.6 bits (46), Expect = 6.4
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -3

Query: 282 TIPQQHEWNKVV 247
           T PQ+H+WN+ +
Sbjct: 88  TPPQKHQWNQTI 99


>AY333999-1|AAR01124.1|  268|Anopheles gambiae FBN23 protein.
          Length = 268

 Score = 22.6 bits (46), Expect = 6.4
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -3

Query: 282 TIPQQHEWNKVV 247
           T PQ+H+WN+ +
Sbjct: 88  TPPQKHQWNQTI 99


>AY333998-1|AAR01123.1|  268|Anopheles gambiae FBN23 protein.
          Length = 268

 Score = 22.6 bits (46), Expect = 6.4
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -3

Query: 282 TIPQQHEWNKVV 247
           T PQ+H+WN+ +
Sbjct: 88  TPPQKHQWNQTI 99


>AY333997-1|AAR01122.1|  268|Anopheles gambiae FBN23 protein.
          Length = 268

 Score = 22.6 bits (46), Expect = 6.4
 Identities = 6/12 (50%), Positives = 10/12 (83%)
 Frame = -3

Query: 282 TIPQQHEWNKVV 247
           T PQ+H+WN+ +
Sbjct: 88  TPPQKHQWNQTI 99


>AJ010193-1|CAA09032.1|  684|Anopheles gambiae prophenoloxidase
           protein.
          Length = 684

 Score = 22.2 bits (45), Expect = 8.4
 Identities = 10/34 (29%), Positives = 21/34 (61%)
 Frame = -3

Query: 417 LKYFFFLIINFRIMDRMKTYDDAXLKQEDAKS*C 316
           ++Y FF++++    DR++ +D+  +   DA S C
Sbjct: 597 IEYDFFVMVSDFAQDRVEDFDE-NVNCNDAHSFC 629


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 408,868
Number of Sequences: 2352
Number of extensions: 7197
Number of successful extensions: 14
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 563,979
effective HSP length: 59
effective length of database: 425,211
effective search space used: 36993357
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)