BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0629 (440 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.0 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.0 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 2.6 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 2.6 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 2.6 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 2.6 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 2.6 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 2.6 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 2.6 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 2.6 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 22 2.6 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 22 2.6 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 22 2.6 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 22 2.6 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 2.6 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 22 3.4 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 3.4 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 22 3.4 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 4.5 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 4.5 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 21 6.0 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 21 6.0 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 21 7.9 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 21 7.9 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 2.0 Identities = 12/44 (27%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 93 AYDLTNACVC-LMFCRCVHV*TQYQFFKMYLYFFFCILYYNLCW 221 +Y ++ C+ LMF C+ + + + Y I YY CW Sbjct: 447 SYAVSGFCLLFLMFFECIAISWAFGVNRFYDGIRDMIGYYPCCW 490 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 2.0 Identities = 12/44 (27%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 93 AYDLTNACVC-LMFCRCVHV*TQYQFFKMYLYFFFCILYYNLCW 221 +Y ++ C+ LMF C+ + + + Y I YY CW Sbjct: 500 SYAVSGFCLLFLMFFECIAISWAFGVNRFYDGIRDMIGYYPCCW 543 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 204 YYNLCWNNKQTNKKKLLYSIRVV 272 Y N NN N KKL Y+I + Sbjct: 94 YNNYNNNNNYNNYKKLYYNINYI 116 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 204 YYNLCWNNKQTNKKKLLYSIRVV 272 Y N NN N KKL Y+I + Sbjct: 94 YNNYNNNNNYNNYKKLYYNINYI 116 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 204 YYNLCWNNKQTNKKKLLYSIRVV 272 Y N NN N KKL Y+I + Sbjct: 94 YNNYNNNNNYNNYKKLYYNINYI 116 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 204 YYNLCWNNKQTNKKKLLYSIRVV 272 Y N NN N KKL Y+I + Sbjct: 94 YNNYNNNNNYNNYKKLYYNINYI 116 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 204 YYNLCWNNKQTNKKKLLYSIRVV 272 Y N NN N KKL Y+I + Sbjct: 94 YNNYNNNNNYNNYKKLYYNINYI 116 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 204 YYNLCWNNKQTNKKKLLYSIRVV 272 Y N NN N KKL Y+I + Sbjct: 94 YNNYNNNNNYNNYKKLYYNINYI 116 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 204 YYNLCWNNKQTNKKKLLYSIRVV 272 Y N NN N KKL Y+I + Sbjct: 94 YNNYNNNNNYNNYKKLYYNINYI 116 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 204 YYNLCWNNKQTNKKKLLYSIRVV 272 Y N NN N KKL Y+I + Sbjct: 94 YNNYNNNNNYNNYKKLYYNINYI 116 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 207 YNLCWNNKQTNKKKLLYSIRVV 272 YN NN N KKL Y+I + Sbjct: 98 YNYNNNNYNNNCKKLYYNINYI 119 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 207 YNLCWNNKQTNKKKLLYSIRVV 272 YN NN N KKL Y+I + Sbjct: 98 YNYNNNNYNNNCKKLYYNINYI 119 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 207 YNLCWNNKQTNKKKLLYSIRVV 272 YN NN N KKL Y+I + Sbjct: 98 YNYNNNNYNNNCKKLYYNINYI 119 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 207 YNLCWNNKQTNKKKLLYSIRVV 272 YN NN N KKL Y+I + Sbjct: 98 YNYNNNNYNNNCKKLYYNINYI 119 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 2.6 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +3 Query: 207 YNLCWNNKQTNKKKLLYSIRVV 272 YN NN N KKL Y+I + Sbjct: 337 YNNYNNNYNNNYKKLYYNINYI 358 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.8 bits (44), Expect = 3.4 Identities = 6/22 (27%), Positives = 14/22 (63%) Frame = +3 Query: 213 LCWNNKQTNKKKLLYSIRVVVE 278 + W K+T+ + Y++ +V+E Sbjct: 292 IMWGTKETSTRTDAYTVEIVLE 313 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 3.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 207 YNLCWNNKQTNKKKLLYSI 263 YN NN N KKL Y+I Sbjct: 338 YNNYNNNNYNNYKKLYYNI 356 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.8 bits (44), Expect = 3.4 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = +3 Query: 204 YYNLCWNNKQTNKKKLLYSIRVVVESFL 287 +Y L WNN Q+N + + + + E+F+ Sbjct: 10 HYCLRWNNYQSNMTSVFHQL-LQTEAFV 36 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 4.5 Identities = 14/58 (24%), Positives = 23/58 (39%) Frame = +3 Query: 84 VVCAYDLTNACVCLMFCRCVHV*TQYQFFKMYLYFFFCILYYNLCWNNKQTNKKKLLY 257 VV D+ C+ L + + V + Q L+ Y L W K+ K+L+ Sbjct: 47 VVNTSDVLRVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVKMLH 104 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 4.5 Identities = 14/58 (24%), Positives = 23/58 (39%) Frame = +3 Query: 84 VVCAYDLTNACVCLMFCRCVHV*TQYQFFKMYLYFFFCILYYNLCWNNKQTNKKKLLY 257 VV D+ C+ L + + V + Q L+ Y L W K+ K+L+ Sbjct: 47 VVNTSDVLRVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVKMLH 104 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 222 NNKQTNKKKLLYSIRVV 272 NN N KKL Y+I + Sbjct: 98 NNNYNNYKKLYYNINYI 114 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 222 NNKQTNKKKLLYSIRVV 272 NN N KKL Y+I + Sbjct: 108 NNNYNNYKKLYYNINYI 124 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 433 HITFLIKILFFFNNQ 389 H FLI I+F ++N+ Sbjct: 11 HSIFLILIIFIYSNE 25 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 20.6 bits (41), Expect = 7.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = -2 Query: 433 HITFLIKILFFFNNQ 389 H FLI I+F ++N+ Sbjct: 11 HSIFLILIIFIYSNE 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,503 Number of Sequences: 438 Number of extensions: 1979 Number of successful extensions: 25 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11450997 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -