BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0620 (645 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) 28 7.5 SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) 28 7.5 SB_26400| Best HMM Match : RVT_1 (HMM E-Value=1.1e-30) 28 7.5 SB_16848| Best HMM Match : Ion_trans_2 (HMM E-Value=0.083) 27 9.9 SB_24560| Best HMM Match : Ank (HMM E-Value=0) 27 9.9 >SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 31.5 bits (68), Expect = 0.61 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +2 Query: 296 EDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPK-HALFL 424 E+ + V KL D L NKG PH N ++E DPK H LF+ Sbjct: 341 EESVDVTKL-DYYLMNKGYIPHADRLNDTLHHYETDPKYHRLFI 383 >SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 201 SMVRFQS*SRLSSVCSPIVHQLSSRRDSRLCVSSSSPSAHL*GP 70 S + +S S SSVC ++H+LS+ R +C S A+ P Sbjct: 430 SYIVCRSISYTSSVCRSVIHRLSANRSKTVCRSIGHTGAYTGAP 473 >SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) Length = 367 Score = 27.9 bits (59), Expect = 7.5 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -2 Query: 149 LFISFRLG--ETVGSVFLQVLLLLICEGLSQDNADDEHDK 36 LF++F G E VG F+ L CE D DD+H++ Sbjct: 305 LFLAFNRGYRELVGRAFIYTCCTL-CEIAEDDENDDDHER 343 >SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) Length = 1214 Score = 27.9 bits (59), Expect = 7.5 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +3 Query: 201 KKYALCMLIKSQLMTKDGNSRRTSLWLKCLMLK 299 ++ ALC +I+++L+TKDG S + + C L+ Sbjct: 1175 RRNALCEVIENRLVTKDGRSLSQAGRILCYRLR 1207 >SB_26400| Best HMM Match : RVT_1 (HMM E-Value=1.1e-30) Length = 1084 Score = 27.9 bits (59), Expect = 7.5 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 6/116 (5%) Frame = +2 Query: 89 EGELEETQSRLSLRDES**TIGEQTEDRRL*D*KRTIEEVCSMYADQIT------ADDQG 250 EG+ E T +LS DES T+ ++ L D + I+E ++ + A D+ Sbjct: 16 EGDKENTSEKLSKTDESSNTVVAVSD---LNDKQYLIQEQWELFGWVLALHFGFRARDES 72 Query: 251 REFKKDVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHAL 418 R+ K D+AL K P ++ V + G HQ A+ + +H+L Sbjct: 73 RKLKWDIALEKEPETGNEDLVWRAERRSKTRHGEG-HQCAFFPIVVVKSPSSRHSL 127 >SB_16848| Best HMM Match : Ion_trans_2 (HMM E-Value=0.083) Length = 283 Score = 27.5 bits (58), Expect = 9.9 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +2 Query: 314 EKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHALFL*THNPTQPFHTSLVLNSS 478 +K++D L ++ TA +YV+ YHE KH+L +H V++S+ Sbjct: 197 KKIVDGILIDR-----YTAGSYVRHYHENKLKHSLISASHVQISGQQIGFVISSN 246 >SB_24560| Best HMM Match : Ank (HMM E-Value=0) Length = 248 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -2 Query: 104 LQVLLLLICEGLSQDNADDEHDKSLHDALCLGS 6 ++V LL+ +G + D +D+ + LH A C+GS Sbjct: 64 MEVGRLLVEKGAALDKKNDKGETPLHMAACIGS 96 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,269,286 Number of Sequences: 59808 Number of extensions: 389249 Number of successful extensions: 1020 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 978 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1020 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -