BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0612 (545 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1215.01 |shy1||SURF-family protein Shy1|Schizosaccharomyces ... 59 4e-10 >SPBC1215.01 |shy1||SURF-family protein Shy1|Schizosaccharomyces pombe|chr 2|||Manual Length = 290 Score = 59.3 bits (137), Expect = 4e-10 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = +1 Query: 271 ILLMIPVTSFTLGSWQVYRWQWKLGLIDMMQAKSNAVPIDMPKDFSE--LEKMEYXPVKX 444 +L +P+ +F LG+WQV R +WK+G+I+ + + I +PK +E +K+E+ V Sbjct: 42 LLSAVPIVTFALGTWQVKRREWKMGIINTLTERLQQPAILLPKTVTEQDTKKLEWTRVLL 101 Query: 445 XXEFLHXXEILIGPR 489 F H E+L+GPR Sbjct: 102 RGVFCHDQEMLVGPR 116 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,920,761 Number of Sequences: 5004 Number of extensions: 34862 Number of successful extensions: 73 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 225926624 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -