Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0612
         (545 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF510715-1|AAP47144.1|  470|Anopheles gambiae Rh-like glycoprote...    24   3.8  

>AF510715-1|AAP47144.1|  470|Anopheles gambiae Rh-like glycoprotein
           protein.
          Length = 470

 Score = 23.8 bits (49), Expect = 3.8
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 4/49 (8%)
 Frame = -3

Query: 324 VHLP*TKSKGSN---WYHQ*DPFVY-FIGSSFLLTFCDRIIFAIFVLNL 190
           VH P  +S+G N   + H  D  V  F G +FL+TF  R  F+   LNL
Sbjct: 45  VHSP-AESEGGNLRKYPHFQDIHVMIFAGFAFLMTFLKRYGFSASGLNL 92


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 462,898
Number of Sequences: 2352
Number of extensions: 7909
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 50460840
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)