BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0599 (569 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19330.2 68418.m02304 armadillo/beta-catenin repeat family pr... 33 0.18 At5g63970.1 68418.m08032 copine-related low similarity to SP|Q99... 29 2.9 >At5g19330.2 68418.m02304 armadillo/beta-catenin repeat family protein / BTB/POZ domain-containing protein contains armadillo/beta-catenin-like repeats, Pfam:PF00514 and a BTB/POZ domain, Pfam:PF00651 Length = 636 Score = 32.7 bits (71), Expect = 0.18 Identities = 17/59 (28%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +1 Query: 49 AIFDRRVYVISMESSEVAKEEVVQETGDLNGAKAGPDTDREAGE-SSGVLIQLEEEAQD 222 A+ DR + +S + + EV + LN A + ++DR A + ++ VL +L + A+D Sbjct: 29 AVEDREISAVSTDGGQALLSEVAAQVSVLNSAFSWQESDRAAAKRATQVLAELAKNAED 87 >At5g63970.1 68418.m08032 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 367 Score = 28.7 bits (61), Expect = 2.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = -3 Query: 126 RLLDNFLFSNFTRLHADHVDSA 61 R DNF F NFT++ ++H D+A Sbjct: 225 REFDNFQFVNFTKIMSEHKDAA 246 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,489,275 Number of Sequences: 28952 Number of extensions: 154725 Number of successful extensions: 418 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1102220672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -