BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0587 (518 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC328.06 |ubp2||ubiquitin C-terminal hydrolase Ubp2|Schizosacc... 31 0.078 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 28 0.96 SPCC24B10.22 ||SPCPB16A4.01|mitochondrial DNA polymerase gamma c... 27 1.7 SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyc... 25 5.1 SPAC7D4.02c |||src |Schizosaccharomyces pombe|chr 1|||Manual 25 6.8 SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe... 25 9.0 SPAC31F12.01 |zds1|SPAC637.14, mug88|zds family protein Zds1|Sch... 25 9.0 >SPAC328.06 |ubp2||ubiquitin C-terminal hydrolase Ubp2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1141 Score = 31.5 bits (68), Expect = 0.078 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +3 Query: 240 CDGGERNLHVGVVHSASKPNIEKPKPGFGKSYRRIVHFPEQYTVKP 377 C ++LHV V KP IE+P+ +G R V++ E+ +P Sbjct: 64 CQKTRKHLHVKVRRDRGKPLIEEPEENYGIKDRIPVYYEEEELPEP 109 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 27.9 bits (59), Expect = 0.96 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 245 IAVAMVKLEKSLFKAIIYLILKLK 174 + + +K+EKSL+K YL L LK Sbjct: 1061 LPILSIKIEKSLYKGFCYLYLTLK 1084 >SPCC24B10.22 ||SPCPB16A4.01|mitochondrial DNA polymerase gamma catalytic subunit|Schizosaccharomyces pombe|chr 3|||Manual Length = 1018 Score = 27.1 bits (57), Expect = 1.7 Identities = 14/24 (58%), Positives = 16/24 (66%) Frame = -3 Query: 96 YLHNLLIHV*NHEAYKLYLEVRLS 25 YLH LL+ + NH K YLE RLS Sbjct: 861 YLHLLLVSM-NHLIKKYYLEARLS 883 >SPCC70.05c |||serine/threonine protein kinase |Schizosaccharomyces pombe|chr 3|||Manual Length = 781 Score = 25.4 bits (53), Expect = 5.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +3 Query: 252 ERNLHVGVVHSASKPNIEKPKPGFG 326 E+ +H G +A+ P E P GFG Sbjct: 127 EKAMHPGHKSNANSPTSESPSKGFG 151 >SPAC7D4.02c |||src |Schizosaccharomyces pombe|chr 1|||Manual Length = 415 Score = 25.0 bits (52), Expect = 6.8 Identities = 16/50 (32%), Positives = 28/50 (56%) Frame = +1 Query: 181 FKIKYIMALNRLFSNLTIATAMVASEIFTLVLFILRVNPI*KSRNLVSEK 330 F +Y+ N+ FSN TI+ + A+ + ++ FIL NP+ ++ V K Sbjct: 87 FMKEYVDRENK-FSNETISKSSAAALMTSMENFILFTNPVYHNKLQVPSK 135 >SPBC27B12.11c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 738 Score = 24.6 bits (51), Expect = 9.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 315 PGFGKSYRRIVHFPEQYTVKPLEVTNLAGRDPET 416 P + Y+ I H +Q +P+E T+ A P T Sbjct: 31 PDYDAEYQFINHHMQQLLTRPVEGTHSASVHPST 64 >SPAC31F12.01 |zds1|SPAC637.14, mug88|zds family protein Zds1|Schizosaccharomyces pombe|chr 1|||Manual Length = 938 Score = 24.6 bits (51), Expect = 9.0 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -1 Query: 446 PPDTFXDHTSCFWIPSS 396 PP+T D ++ FW+P++ Sbjct: 170 PPETEQDASTLFWVPAN 186 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,070,347 Number of Sequences: 5004 Number of extensions: 40547 Number of successful extensions: 92 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 92 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 210309424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -