BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0587 (518 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing ... 30 5.6 L08961-1|AAC41766.1| 600|Homo sapiens tyrosine kinase protein. 29 9.8 >AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing 4 protein. Length = 1362 Score = 29.9 bits (64), Expect = 5.6 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +3 Query: 252 ERNLHVGVVHSAS-KPNIEKPKPGFGKSYRRIVHFPEQYTVKPLEVTNLAGRDPE 413 E +H ++ S P++ P +S + VH P++ +KP++V R PE Sbjct: 1112 EEKIHSPIIRSEPFSPSLRPEPPKHPESIKAPVHLPQRPEMKPVDVGRPVIRPPE 1166 >L08961-1|AAC41766.1| 600|Homo sapiens tyrosine kinase protein. Length = 600 Score = 29.1 bits (62), Expect = 9.8 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = -2 Query: 448 LLRIPLX---TTRPVS-GSLPARFVTSKGFTVYCSGKCTIRL*LFPKPGFGFSILGLLAE 281 LL++P+ T RP++ S+ R + K + C KCT+ PK G FS+L L E Sbjct: 486 LLKLPILGSRTMRPMTIFSMATRLSSPKTAWMNCMKKCTLAGEPIPKTGPTFSVLRLQLE 545 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,725,680 Number of Sequences: 237096 Number of extensions: 1381423 Number of successful extensions: 2734 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2681 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2734 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4933413474 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -