BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0587 (518 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13180.1 68416.m01649 NOL1/NOP2/sun family protein / antiterm... 31 0.35 At3g60700.1 68416.m06791 expressed protein 29 1.4 At4g00315.1 68417.m00040 F-box family protein contains F-box dom... 29 2.5 At3g50730.1 68416.m05550 protein kinase, putative similar to pro... 29 2.5 At1g70120.1 68414.m08069 hypothetical protein 29 2.5 At1g73810.1 68414.m08546 expressed protein contains Pfam profile... 28 3.3 At5g19930.1 68418.m02371 integral membrane family protein contai... 28 4.3 At4g28025.1 68417.m04020 expressed protein 28 4.3 At3g26250.1 68416.m03275 DC1 domain-containing protein contains ... 27 5.7 At3g26240.1 68416.m03274 DC1 domain-containing protein contains ... 27 5.7 At1g70020.1 68414.m08058 hypothetical protein 27 7.6 >At3g13180.1 68416.m01649 NOL1/NOP2/sun family protein / antitermination NusB domain-containing protein low similarity to SP|P36929 SUN protein (FMU protein) {Escherichia coli}; contains Pfam profiles PF01189: NOL1/NOP2/sun family, PF01029: NusB family Length = 523 Score = 31.5 bits (68), Expect = 0.35 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = -2 Query: 451 YLLRIPLXTTRPVSGSLPARFVTSKGF 371 +LLR P T PV+ +P+ FVTS+GF Sbjct: 475 FLLRHPEFTIDPVTSFVPSSFVTSQGF 501 >At3g60700.1 68416.m06791 expressed protein Length = 219 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +1 Query: 124 WKSMVNLPNNLPSTVLCLSFKIKYIMALNRLFSNLTIATA 243 W + +P NLP + +CL + + L+ N+TIAT+ Sbjct: 86 WNLSIRVPENLPGSYICLQGDFQ----ASLLYKNITIATS 121 >At4g00315.1 68417.m00040 F-box family protein contains F-box domain Pfam:PF00646 Length = 441 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = -1 Query: 302 YIGFTRRMNNTNVK---ISLATIAVAMVKLEKSLFKAIIYLILKLK 174 Y+ + ++++NV+ + L T A KL KSL+K +ILKLK Sbjct: 96 YLWVSLAVHDSNVRELSLKLCTFAERPTKLPKSLYKCKSIVILKLK 141 >At3g50730.1 68416.m05550 protein kinase, putative similar to protein kinase ATN1 [Arabidopsis thaliana] gi|1054633|emb|CAA63387 Length = 370 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/54 (27%), Positives = 24/54 (44%) Frame = -1 Query: 323 ETRFRLFYIGFTRRMNNTNVKISLATIAVAMVKLEKSLFKAIIYLILKLKHKTV 162 E + + Y G R VKI + A+ K K F+ + L+ K+KH + Sbjct: 44 EGAYSIVYKGLLRNQFPVAVKIMDPSTTSAVTKAHKKTFQKEVLLLSKMKHDNI 97 >At1g70120.1 68414.m08069 hypothetical protein Length = 193 Score = 28.7 bits (61), Expect = 2.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +1 Query: 121 NWKSMVNLPNNLPSTVLCLSFKIK 192 NW ++ +P+NLP+ +CL I+ Sbjct: 65 NWDLLIRVPSNLPNAYICLQGDIQ 88 >At1g73810.1 68414.m08546 expressed protein contains Pfam profile PF03267: Arabidopsis protein of unknown function, DUF266 Length = 418 Score = 28.3 bits (60), Expect = 3.3 Identities = 21/73 (28%), Positives = 28/73 (38%), Gaps = 5/73 (6%) Frame = +2 Query: 293 TQYRKAETWFRKKLQ-AYCTFS*TIYSKTFRSYKSSWKGSRNR----TCGX*RYPEEV*X 457 T +RK WF + A S T Y F Y W + T +P + Sbjct: 287 TNWRKGSQWFEIDREVALAVVSDTTYFPVFEKY-CLWNCYADEHYLSTFVHAMFPGKNAN 345 Query: 458 TNITWIDWYRXGP 496 ++TW DW R GP Sbjct: 346 RSLTWTDWSRRGP 358 >At5g19930.1 68418.m02371 integral membrane family protein contains Pfam domain PF01940: Integral membrane protein Length = 288 Score = 27.9 bits (59), Expect = 4.3 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = -2 Query: 466 DICVLYLLRIPLXTTRPVSGSLPARFVTSKGFTVYCSGKCTIRL*LFPKPG 314 D+ + LL IPL + GSL + G T+ SG C++R + KPG Sbjct: 204 DVALKQLLVIPLSALAGLCGSLIDSIL---GATIQFSGFCSVRNKVVGKPG 251 >At4g28025.1 68417.m04020 expressed protein Length = 157 Score = 27.9 bits (59), Expect = 4.3 Identities = 22/61 (36%), Positives = 28/61 (45%) Frame = +3 Query: 267 VGVVHSASKPNIEKPKPGFGKSYRRIVHFPEQYTVKPLEVTNLAGRDPETGRVVXKGIRR 446 VGVV + PN+ P P GK+ + E V PLE LA + E + K RR Sbjct: 55 VGVVRVLANPNVSPPPPP-GKAKVK----KEVIMVDPLEAKRLASKQMEEIKGREKQQRR 109 Query: 447 R 449 R Sbjct: 110 R 110 >At3g26250.1 68416.m03275 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 490 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -1 Query: 506 DPQ*AXLCTSLSX*YLCXIPPPDTFXDHTSCFWIP 402 DPQ LC + I PP F H SCF +P Sbjct: 42 DPQTCSLCAFKHSNLVFYICPPCDFIVHQSCFSLP 76 >At3g26240.1 68416.m03274 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 922 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = -1 Query: 506 DPQ*AXLCTSLSX*YLCXIPPPDTFXDHTSCFWIP 402 DPQ LC + I PP F H SCF +P Sbjct: 476 DPQTCSLCALKHSNLVFYICPPCDFIIHQSCFSLP 510 >At1g70020.1 68414.m08058 hypothetical protein Length = 225 Score = 27.1 bits (57), Expect = 7.6 Identities = 13/46 (28%), Positives = 25/46 (54%) Frame = +1 Query: 118 VNWKSMVNLPNNLPSTVLCLSFKIKYIMALNRLFSNLTIATAMVAS 255 V W ++ LP++LP +CL ++ + L+ +TIA + + S Sbjct: 92 VKWDLVIRLPSDLPGYYMCLKGDLQTFI----LYKGVTIANSSLDS 133 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,689,322 Number of Sequences: 28952 Number of extensions: 205202 Number of successful extensions: 462 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 462 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -