BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0585 (403 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.15 SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.15 SB_29012| Best HMM Match : Avirulence (HMM E-Value=1.1) 32 0.20 SB_59525| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_37790| Best HMM Match : HAT (HMM E-Value=0.17) 28 2.5 SB_5142| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 SB_5689| Best HMM Match : Ribosomal_L34e (HMM E-Value=0.34) 27 4.3 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 27 7.6 SB_40122| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_39253| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_16742| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_14935| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_13812| Best HMM Match : DUF1004 (HMM E-Value=5.8) 27 7.6 SB_3589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_2597| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_55013| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_32106| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_30084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_15189| Best HMM Match : DUF1004 (HMM E-Value=5.8) 27 7.6 SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_10242| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_8221| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 32.3 bits (70), Expect = 0.15 Identities = 21/70 (30%), Positives = 30/70 (42%) Frame = -2 Query: 216 QRDGSRARHEPRNVINVFYAAGPQTGVVLDVSPRTAMCVRNVDVQMCPAVHXXXXXXXXX 37 Q G R E R + F QT ++L P++A+CV+ D + A+H Sbjct: 156 QSSGMRRLEEERVL---FLETDTQTDMLLG-KPKSAICVQRFDDSLNSAIHTTYRTWLRS 211 Query: 36 XXXREPSDPP 7 EP DPP Sbjct: 212 SSMHEPRDPP 221 >SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 32.3 bits (70), Expect = 0.15 Identities = 21/70 (30%), Positives = 30/70 (42%) Frame = -2 Query: 216 QRDGSRARHEPRNVINVFYAAGPQTGVVLDVSPRTAMCVRNVDVQMCPAVHXXXXXXXXX 37 Q G R E R + F QT ++L P++A+CV+ D + A+H Sbjct: 65 QSSGMRRLEEERVL---FLETDTQTDMLLG-KPKSAICVQRFDDSLNSAIHTTYRTWLRS 120 Query: 36 XXXREPSDPP 7 EP DPP Sbjct: 121 SSMHEPRDPP 130 >SB_29012| Best HMM Match : Avirulence (HMM E-Value=1.1) Length = 444 Score = 31.9 bits (69), Expect = 0.20 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 102 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 215 +T+R V+T P L + RLH H +HC L +R V Sbjct: 370 QTVRIVQTPPDRLCALYRLHHTHSAHCTDTTRLTVRTV 407 Score = 29.1 bits (62), Expect = 1.4 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 102 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 215 +TLR V+T P L + R H+ H +HC +R V Sbjct: 210 QTLRIVQTPPDRLCALYRFHQTHCAHCTDFTRQTVRTV 247 Score = 26.2 bits (55), Expect = 10.0 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 102 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 215 +T+R+V+T P L + R H+ +HC +R V Sbjct: 242 QTVRTVQTPPDRLCALYRFHQTDCAHCTDTTRQTVRTV 279 Score = 26.2 bits (55), Expect = 10.0 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 102 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 215 +T+R+V+T P L + RLH+ +HC +R V Sbjct: 306 QTVRTVQTPPDRLCALYRLHQTDCAHCTDFTRQTVRIV 343 >SB_59525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 29.1 bits (62), Expect = 1.4 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -2 Query: 120 PRTAMCVRNVDVQMCPAVHXXXXXXXXXXXXREPSDPP 7 P++A+CV+ D + A+H EP DPP Sbjct: 6 PKSAICVQRFDDSLNSAIHTTYRTWLRSSSMHEPRDPP 43 >SB_37790| Best HMM Match : HAT (HMM E-Value=0.17) Length = 498 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 82 LNIDISNAHCGPWRHIQDHSCLRAGCIKN 168 L +D+ NA GPW I+ H C + C+ N Sbjct: 287 LKLDMGNA--GPWGDIKIHPCDKPKCLTN 313 >SB_5142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 27.9 bits (59), Expect = 3.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +1 Query: 115 PWRHIQDHSCLRAGCIKNI 171 PWR+ DH CL+ I N+ Sbjct: 5 PWRNAADHHCLKTAIIFNV 23 >SB_5689| Best HMM Match : Ribosomal_L34e (HMM E-Value=0.34) Length = 524 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 102 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 215 +T+R+V+T P L + R H+ +HC +R V Sbjct: 365 QTVRTVQTSPDRLCALYRFHQTDCAHCTVTTRQTVRSV 402 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 106 NGGSLGSCIDEERS 119 >SB_40122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 17 NGGSLGSCIDEERS 30 >SB_39253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 17 NGGSLGSCIDEERS 30 >SB_16742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 17 NGGSLGSCIDEERS 30 >SB_14935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 17 NGGSLGSCIDEERS 30 >SB_13812| Best HMM Match : DUF1004 (HMM E-Value=5.8) Length = 124 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 44 NGGSLGSCIDEERS 57 >SB_3589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 26.6 bits (56), Expect = 7.6 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = +3 Query: 75 DTFEHRHFER-TLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRVDAFRVT 233 D+ + F R T +V+T P + RLH+ +HC ++R V R T Sbjct: 64 DSAHYTDFTRQTAHTVQTSPDRQRTLYRLHQTDSAHCTDFTKQIVRTVQTTRQT 117 >SB_2597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 17 NGGSLGSCIDEERS 30 >SB_55013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 50 NGGSLGSCIDEERS 63 >SB_32106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 31 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 17 NGGSLGSCIDEERS 30 >SB_30084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 26.6 bits (56), Expect = 7.6 Identities = 12/41 (29%), Positives = 18/41 (43%) Frame = +3 Query: 279 PKTTITNRVSLARLSDGSKNVLLLFQNFHNHVEPLWRARYV 401 P + + N L DG ++ + N VEPLW +V Sbjct: 17 PNSPVQNGTLKQSLEDGKDHMSTCYDWSRNEVEPLWLYEHV 57 >SB_15189| Best HMM Match : DUF1004 (HMM E-Value=5.8) Length = 97 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 17 NGGSLGSCIDEERS 30 >SB_10715| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 896 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 714 NGGSLGSCIDEERS 727 >SB_10242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 17 NGGSLGSCIDEERS 30 >SB_8221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 26.6 bits (56), Expect = 7.6 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = +2 Query: 5 DGGSLGSRVDEERS 46 +GGSLGS +DEERS Sbjct: 17 NGGSLGSCIDEERS 30 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,993,457 Number of Sequences: 59808 Number of extensions: 217311 Number of successful extensions: 590 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 715479706 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -