BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0582 (558 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 prot... 25 1.3 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 9.0 >AF236124-1|AAF68382.1| 107|Anopheles gambiae thioredoxin 1 protein. Length = 107 Score = 25.4 bits (53), Expect = 1.3 Identities = 14/66 (21%), Positives = 27/66 (40%) Frame = +2 Query: 260 WCGHCKRLKPEYAVAAGLLKTDVPPVALAKVDCTEGGKSTCEQFSVXGYSTLKIFRXXEL 439 WCG CK + P+ + + KVD E + Q+++ T + E+ Sbjct: 31 WCGPCKVIAPK---LEEFQNKYADKIVVVKVDVDE-CEELAAQYNIASMPTFLFIKRKEV 86 Query: 440 XSEYNG 457 +++G Sbjct: 87 VGQFSG 92 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 22.6 bits (46), Expect = 9.0 Identities = 10/28 (35%), Positives = 12/28 (42%) Frame = +2 Query: 464 ESNGIVKYMPCPSWTSFXELLTVXDSEA 547 + NG +K PSW S E L A Sbjct: 961 DDNGAIKQNEFPSWASNKEYLAYNSPSA 988 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 548,601 Number of Sequences: 2352 Number of extensions: 10654 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 52142868 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -