BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0579 (490 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykin... 26 0.60 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 5.6 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 7.4 >AJ439060-12|CAD27763.1| 450|Anopheles gambiae putative tachykinin receptor protein. Length = 450 Score = 26.2 bits (55), Expect = 0.60 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = +2 Query: 164 SARLAEERKAWRKDHPFGFVARPMKNPDGS 253 SA AE AWR+ P VA P P+G+ Sbjct: 41 SATSAELEIAWRESSPPTLVAGPYPEPNGT 70 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 5.6 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 129 IYEPSFNQGLFLMLGDRFYL 70 IY+P FN+ +ML D YL Sbjct: 2485 IYDPLFNRPSKIMLSDGRYL 2504 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 22.6 bits (46), Expect = 7.4 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 129 IYEPSFNQGLFLMLGDRFYL 70 +Y+P FN+ +ML D YL Sbjct: 2486 VYDPLFNRPSKIMLSDGRYL 2505 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 468,388 Number of Sequences: 2352 Number of extensions: 8734 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43131618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -